Products

View as table Download

Rabbit Polyclonal Anti-G6PC Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-G6PC antibody: synthetic peptide directed towards the N terminal of human G6PC. Synthetic peptide located within the following region: NLVFKWILFGQRPYWWVLDTDYYSNTSVPLIKQFPVTCETGPGSPSGHAM

Lenti ORF particles, G6PC (Myc-DDK tagged) - Human glucose-6-phosphatase, catalytic subunit (G6PC), 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, G6PC (mGFP-tagged) - Human glucose-6-phosphatase, catalytic subunit (G6PC), 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

Transient overexpression lysate of glucose-6-phosphatase, catalytic subunit (G6PC)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB

Special Offer: Get a 20% discount on this product. Use code: "OEL20".

Lenti ORF clone of Human glucose-6-phosphatase, catalytic subunit (G6PC), Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Rabbit Polyclonal Anti-G6pc Antibody

Applications WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-G6pc antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: DFGIQSTRYLQVNYQDSQDWFILVSVIADLRNAFYVLFPIWFHLKETVGI

Transient overexpression of G6PC (NM_000151) in HEK293T cells paraffin embedded controls for ICC/IHC staining

Transient overexpression of G6PC (NM_001270397) in HEK293T cells paraffin embedded controls for ICC/IHC staining

Transient overexpression of G6PC (NM_000151) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

Transient overexpression of G6PC (NM_000151) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack

Transient overexpression of G6PC (NM_001270397) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack