PDX1 (Myc-DDK-tagged)-Human pancreatic and duodenal homeobox 1 (PDX1)
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
PDX1 (Myc-DDK-tagged)-Human pancreatic and duodenal homeobox 1 (PDX1)
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
PDX1 (untagged)-Human pancreatic and duodenal homeobox 1 (PDX1)
Vector | pCMV6-XL5 |
Tag | Tag Free |
Mammalian Cell Selection | None |
PDX1 (GFP-tagged) - Human pancreatic and duodenal homeobox 1 (PDX1)
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
Lenti ORF particles, PDX1 (Myc-DDK tagged) - Human pancreatic and duodenal homeobox 1 (PDX1), 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK |
Tag | Myc-DDK |
Lenti ORF clone of Human pancreatic and duodenal homeobox 1 (PDX1), Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, PDX1 (Myc-DDK tagged) - Human pancreatic and duodenal homeobox 1 (PDX1), 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF clone of Human pancreatic and duodenal homeobox 1 (PDX1), mGFP tagged
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, PDX1 (mGFP-tagged) - Human pancreatic and duodenal homeobox 1 (PDX1), 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti ORF clone of Human pancreatic and duodenal homeobox 1 (PDX1), mGFP tagged
Vector | pLenti-C-mGFP |
Tag | mGFP |
Mammalian Cell Selection | None |
Lenti ORF clone of Human pancreatic and duodenal homeobox 1 (PDX1), Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK |
Tag | Myc-DDK |
Mammalian Cell Selection | None |
Lenti ORF particles, PDX1 (mGFP-tagged) - Human pancreatic and duodenal homeobox 1 (PDX1), 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP |
Tag | mGFP |
Mammalian Cell Selection | None |
Transient overexpression lysate of pancreatic and duodenal homeobox 1 (PDX1)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
Rabbit anti-PDX1 Polyclonal Antibody
Applications | WB |
Reactivities | Mouse |
Conjugation | Unconjugated |
Immunogen | A synthetic peptide of human PDX1 |
PDX1 HEK293T cell transient overexpression lysate (as WB positive control)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Rabbit Polyclonal PDX-1/IPF1 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | A synthetic peptide made to a C-terminal portion of the human PDX1 protein (between residues 100-200) [UniProt P52945] |
Rabbit polyclonal IPF Antibody (C-term)
Applications | IF, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | This IPF antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 186-215 amino acids from the C-terminal region of human IPF. |
Rabbit Polyclonal Anti-PDX1 Antibody
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-PDX1 antibody: synthetic peptide directed towards the N terminal of human PDX1. Synthetic peptide located within the following region: MNGEEQYYAATQLYKDPCAFQRGPAPEFSASPPACLYMGRQPPPPPPHPF |
Purified recombinant protein of Human pancreatic and duodenal homeobox 1 (PDX1), with N-terminal HIS tag, expressed in E.Coli, 50ug
Tag | N-His |
Expression Host | E. coli |
Rabbit anti PDX-1 Polyclonal Antibody
Reactivities | Human |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) Pdx1 mouse monoclonal antibody, clone OTI2A12 (formerly 2A12)
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) Pdx1 mouse monoclonal antibody, clone OTI5D5 (formerly 5D5)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) PDX1 mouse monoclonal antibody, clone OTI1E1 (formerly 1E1)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) PDX1 mouse monoclonal antibody, clone OTI4D8 (formerly 4D8)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) PDX1 mouse monoclonal antibody, clone OTI4H7 (formerly 4H7)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) PDX1 mouse monoclonal antibody, clone OTI3H3 (formerly 3H3)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) PDX1 mouse monoclonal antibody, clone OTI7F7 (formerly 7F7)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
PDX1 MS Standard C13 and N15-labeled recombinant protein (NP_000200)
Tag | C-Myc/DDK |
Expression Host | HEK293 |
Anti-PDX1 Rabbit Polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide peptide corresponding to a region derived from 18-31 amino acids of human pancreatic and duodenal homeobox 1 |
Anti-PDX1 Rabbit Polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide peptide corresponding to a region derived from 18-31 amino acids of human pancreatic and duodenal homeobox 1 |
Pdx1 mouse monoclonal antibody, clone OTI2A12 (formerly 2A12)
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Pdx1 mouse monoclonal antibody, clone 2A12, Biotinylated
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Biotin |
Pdx1 mouse monoclonal antibody, clone 2A12, HRP conjugated
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | HRP |
Pdx1 mouse monoclonal antibody, clone OTI2A12 (formerly 2A12)
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Pdx1 mouse monoclonal antibody, clone OTI5D5 (formerly 5D5)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Pdx1 mouse monoclonal antibody, clone OTI5D5 (formerly 5D5), Biotinylated
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Biotin |
Pdx1 mouse monoclonal antibody, clone OTI5D5 (formerly 5D5), HRP conjugated
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | HRP |
Pdx1 mouse monoclonal antibody, clone OTI5D5 (formerly 5D5)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
PDX1 mouse monoclonal antibody, clone OTI1E1 (formerly 1E1)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
PDX1 mouse monoclonal antibody, clone OTI1E1 (formerly 1E1), Biotinylated
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Biotin |
PDX1 mouse monoclonal antibody, clone OTI1E1 (formerly 1E1), HRP conjugated
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | HRP |
PDX1 mouse monoclonal antibody, clone OTI1E1 (formerly 1E1)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
PDX1 mouse monoclonal antibody, clone OTI4D8 (formerly 4D8)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
PDX1 mouse monoclonal antibody, clone OTI4D8 (formerly 4D8), Biotinylated
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Biotin |
PDX1 mouse monoclonal antibody, clone OTI4D8 (formerly 4D8), HRP conjugated
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | HRP |
PDX1 mouse monoclonal antibody, clone OTI4D8 (formerly 4D8)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
PDX1 mouse monoclonal antibody, clone OTI4H7 (formerly 4H7)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
PDX1 mouse monoclonal antibody, clone OTI4H7 (formerly 4H7), Biotinylated
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Biotin |
PDX1 mouse monoclonal antibody, clone OTI4H7 (formerly 4H7), HRP conjugated
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | HRP |
PDX1 mouse monoclonal antibody, clone OTI4H7 (formerly 4H7)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
PDX1 mouse monoclonal antibody, clone OTI3H3 (formerly 3H3)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |