Products

cDNA Clones (35)
Proteins (15)
Antibodies (2)
Jump to Filters
View as table Download
GATA2 (NM_001145661) Human Tagged ORF Clone
RC227363

USD 420.00

In Stock

GATA2 (Myc-DDK-tagged)-Human GATA binding protein 2 (GATA2), transcript variant 1

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
GATA2 (NM_032638) Human Tagged ORF Clone
RC208554

USD 420.00

In Stock

GATA2 (Myc-DDK-tagged)-Human GATA binding protein 2 (GATA2), transcript variant 2

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
GATA2 (NM_032638) Human Untagged Clone
SC125368

USD 310.00

In Stock

GATA2 (untagged)-Human GATA binding protein 2 (GATA2), transcript variant 2

Vector pCMV6-XL6
Tag Tag Free
Mammalian Cell Selection None
GATA2 (NM_001145661) Human Tagged ORF Clone
RG227363

USD 460.00

In Stock

GATA2 (GFP-tagged) - Human GATA binding protein 2 (GATA2), transcript variant 1

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
GATA2 (NM_032638) Human Tagged ORF Clone Lentiviral Particle
RC208554L1V

USD 820.00

3 Weeks

Lenti ORF particles, GATA2 (Myc-DDK tagged) - Human GATA binding protein 2 (GATA2), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
  • LentiORF®
GATA2 (NM_032638) Human Tagged ORF Clone Lentiviral Particle
RC208554L2V

USD 820.00

3 Weeks

Lenti ORF particles, GATA2 (mGFP-tagged) - Human GATA binding protein 2 (GATA2), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP
Tag mGFP
  • LentiORF®
GATA2 (NM_001145661) Human Tagged ORF Clone Lentiviral Particle
RC227363L1V

USD 820.00

3 Weeks

Lenti ORF particles, GATA2 (Myc-DDK tagged) - Human GATA binding protein 2 (GATA2), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
  • LentiORF®
GATA2 (NM_001145661) Human Tagged ORF Clone Lentiviral Particle
RC227363L2V

USD 820.00

3 Weeks

Lenti ORF particles, GATA2 (mGFP-tagged) - Human GATA binding protein 2 (GATA2), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP
Tag mGFP
  • LentiORF®
GATA2 (NM_001145662) Human Tagged ORF Clone Lentiviral Particle
RC227514L1V

USD 820.00

3 Weeks

Lenti ORF particles, GATA2 (Myc-DDK-tagged)-Human GATA binding protein 2 (GATA2), transcript variant 3, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
  • LentiORF®
GATA2 (NM_001145662) Human Tagged ORF Clone Lentiviral Particle
RC227514L2V

USD 820.00

6 Weeks

Lenti ORF particles, GATA2 (mGFP-tagged)-Human GATA binding protein 2 (GATA2), transcript variant 3, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP
Tag mGFP
  • LentiORF®
GATA2 (NM_001145662) Human Tagged ORF Clone
RC227514

USD 420.00

In Stock

GATA2 (Myc-DDK-tagged)-Human GATA binding protein 2 (GATA2), transcript variant 3

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
GATA2 (NM_032638) Human Tagged ORF Clone
RG208554

USD 460.00

In Stock

GATA2 (GFP-tagged) - Human GATA binding protein 2 (GATA2), transcript variant 2

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
GATA2 (NM_032638) Human Tagged ORF Clone
RC208554L3

USD 620.00

3 Weeks

Lenti ORF clone of Human GATA binding protein 2 (GATA2), transcript variant 2, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
GATA2 (NM_032638) Human Tagged ORF Clone Lentiviral Particle
RC208554L3V

USD 820.00

5 Weeks

Lenti ORF particles, GATA2 (Myc-DDK tagged) - Human GATA binding protein 2 (GATA2), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
GATA2 (NM_032638) Human Tagged ORF Clone
RC208554L4

USD 620.00

3 Weeks

Lenti ORF clone of Human GATA binding protein 2 (GATA2), transcript variant 2, mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
GATA2 (NM_032638) Human Tagged ORF Clone Lentiviral Particle
RC208554L4V

USD 820.00

5 Weeks

Lenti ORF particles, GATA2 (mGFP-tagged) - Human GATA binding protein 2 (GATA2), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
GATA2 (NM_001145661) Human Tagged ORF Clone Lentiviral Particle
RC227363L3V

USD 820.00

7 Weeks

Lenti ORF particles, GATA2 (Myc-DDK tagged) - Human GATA binding protein 2 (GATA2), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
GATA2 (NM_001145661) Human Tagged ORF Clone
RC227363L4

USD 620.00

In Stock

Lenti ORF clone of Human GATA binding protein 2 (GATA2), transcript variant 1, mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
GATA2 (NM_001145661) Human Tagged ORF Clone Lentiviral Particle
RC227363L4V

USD 820.00

3 Weeks

Lenti ORF particles, GATA2 (mGFP-tagged) - Human GATA binding protein 2 (GATA2), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
GATA2 (NM_001145662) Human Tagged ORF Clone
RC227514L3

USD 620.00

3 Weeks

Lenti-ORF clone of GATA2 (Myc-DDK-tagged)-Human GATA binding protein 2 (GATA2), transcript variant 3

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
GATA2 (NM_001145662) Human Tagged ORF Clone Lentiviral Particle
RC227514L3V

USD 820.00

11 Weeks

Lenti ORF particles, GATA2 (Myc-DDK-tagged)-Human GATA binding protein 2 (GATA2), transcript variant 3, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
GATA2 (NM_001145662) Human Tagged ORF Clone
RC227514L4

USD 620.00

3 Weeks

Lenti-ORF clone of GATA2 (mGFP-tagged)-Human GATA binding protein 2 (GATA2), transcript variant 3

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
GATA2 (NM_001145662) Human Tagged ORF Clone Lentiviral Particle
RC227514L4V

USD 820.00

11 Weeks

Lenti ORF particles, GATA2 (mGFP-tagged)-Human GATA binding protein 2 (GATA2), transcript variant 3, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
GATA2 (NM_001145662) Human Tagged ORF Clone
RG227514

USD 460.00

3 Weeks

GATA2 (GFP-tagged) - Human GATA binding protein 2 (GATA2), transcript variant 3

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
GATA2 (NM_001145661) Human Untagged Clone
SC326484

USD 760.00

In Stock

GATA2 (untagged)-Human GATA binding protein 2 (GATA2), transcript variant 1, mRNA

Vector pCMV6-XL4
Tag Tag Free
Mammalian Cell Selection None
GATA2 (NM_032638) Human Untagged Clone
SC321007

USD 310.00

In Stock

GATA2 (untagged)-Human GATA binding protein 2 (GATA2), transcript variant 2

Vector pCMV6-AC
Tag Tag Free
Mammalian Cell Selection Neomycin
GATA2 (NM_001145661) Human Tagged Lenti ORF Clone
RC227363L1

USD 768.00

In Stock

Lenti ORF clone of Human GATA binding protein 2 (GATA2), transcript variant 1, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
Mammalian Cell Selection None
  • LentiORF®
GATA2 (NM_032638) Human Tagged Lenti ORF Clone
RC208554L2

USD 768.00

In Stock

Lenti ORF clone of Human GATA binding protein 2 (GATA2), transcript variant 2, mGFP tagged

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®
GATA2 (NM_001145661) Human Tagged Lenti ORF Clone
RC227363L2

USD 768.00

In Stock

Lenti ORF clone of Human GATA binding protein 2 (GATA2), transcript variant 1, mGFP tagged

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®
GATA2 (NM_001145662) Human Tagged Lenti ORF Clone
RC227514L1

USD 768.00

In Stock

Lenti-ORF clone of GATA2 (Myc-DDK-tagged)-Human GATA binding protein 2 (GATA2), transcript variant 3

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
Mammalian Cell Selection None
  • LentiORF®
GATA2 (BC015613) Human Untagged Clone
SC125748

USD 310.00

In Stock

GATA2 (untagged)-Human GATA binding protein 2, mRNA (cDNA clone MGC:23183 IMAGE:4811349), complete cds

Vector pCMV6-XL5
Tag Tag Free
Mammalian Cell Selection None
GATA2 (NM_032638) Human Over-expression Lysate
LY403182

USD 396.00

In Stock

Transient overexpression lysate of GATA binding protein 2 (GATA2), transcript variant 2

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
GATA2 (NM_032638) Human Tagged ORF Clone
RC208554L1

USD 620.00

In Stock

Lenti ORF clone of Human GATA binding protein 2 (GATA2), transcript variant 2, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
Mammalian Cell Selection None
  • LentiORF®
GATA2 (NM_001145661) Human Tagged ORF Clone
RC227363L3

USD 768.00

3 Weeks

Lenti ORF clone of Human GATA binding protein 2 (GATA2), transcript variant 1, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
GATA2 (NM_001145661) Human Over-expression Lysate
LY428960

USD 396.00

In Stock

Transient overexpression lysate of GATA binding protein 2 (GATA2), transcript variant 1

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
GATA2 Rabbit Polyclonal Antibody
TA312431

USD 345.00

In Stock

Rabbit polyclonal GATA2 (Ser401) antibody(Phospho-specific)

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized phosphopeptide derived from human GATA2 around the phosphorylation site of serine 401 (K-M-SP-N-K).
Modifications Phospho-specific
GATA2 Rabbit Polyclonal Antibody
TA329422

USD 310.00

5 Days

Rabbit Polyclonal anti-GATA2 antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-GATA2 antibody: synthetic peptide directed towards the N terminal of human GATA2. Synthetic peptide located within the following region: PYYANPAHARARVSYSPAHARLTGGQMCRPHLLHSPGLPWLDGGKAALSA
GATA2 (NM_001145662) Human Tagged ORF Clone
RC227514L2

USD 620.00

3 Weeks

Lenti-ORF clone of GATA2 (mGFP-tagged)-Human GATA binding protein 2 (GATA2), transcript variant 3

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®
GATA2 (NM_032638) Human Over-expression Lysate
LC403182

USD 121.00

In Stock

GATA2 HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
GATA2 (NM_001145661) Human Over-expression Lysate
LC428960

USD 121.00

In Stock

GATA2 HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
GATA2 (NM_032638) Human Mass Spec Standard
PH308554

USD 2,055.00

3 Weeks

GATA2 MS Standard C13 and N15-labeled recombinant protein (NP_116027)

Tag C-Myc/DDK
Expression Host HEK293
GATA2 (NM_001145662) Human Untagged Clone
SC326481

USD 760.00

3 Weeks

GATA2 (untagged)-Human GATA binding protein 2 (GATA2), transcript variant 3, mRNA

Vector pCMV6-Entry
Tag Tag Free
Mammalian Cell Selection Neomycin
GATA2 ICC Control Block
TB408554

USD 1,070.00

4 Weeks

Transient overexpression of GATA2 (NM_032638) in HEK293T cells paraffin embedded controls for ICC/IHC staining

GATA2 ICC Control Block
TB427363

USD 1,070.00

4 Weeks

Transient overexpression of GATA2 (NM_001145661) in HEK293T cells paraffin embedded controls for ICC/IHC staining

GATA2 ICC Control Block
TB427514

USD 1,070.00

4 Weeks

Transient overexpression of GATA2 (NM_001145662) in HEK293T cells paraffin embedded controls for ICC/IHC staining

GATA2 Cytosection
TS408554

USD 225.00

4 Weeks

Transient overexpression of GATA2 (NM_032638) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

GATA2 Cytosection
TS408554P5

USD 889.00

4 Weeks

Transient overexpression of GATA2 (NM_032638) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack

GATA2 Cytosection
TS427363

USD 225.00

4 Weeks

Transient overexpression of GATA2 (NM_001145661) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

GATA2 Cytosection
TS427363P5

USD 889.00

4 Weeks

Transient overexpression of GATA2 (NM_001145661) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack