Products

View as table Download

GDF5 (Myc-DDK-tagged)-Human growth differentiation factor 5 (GDF5)

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin

GDF5 (GFP-tagged) - Human growth differentiation factor 5 (GDF5)

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®

Lenti ORF clone of Human growth differentiation factor 5 (GDF5), Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF clone of Human growth differentiation factor 5 (GDF5), mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

GDF5 (untagged)-Human growth differentiation factor 5 (GDF5)

Vector pCMV6-XL5
Tag Tag Free
Mammalian Cell Selection None

Lenti ORF clone of Human growth differentiation factor 5 (GDF5), mGFP tagged

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®

GDF 5 (GDF5) (C-term) rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen conjugated synthetic peptide between 350-379 amino acids from the C-terminal region of human BMP14 / GDF5

Rabbit Polyclonal Anti-GDF5 Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-GDF5 antibody is: synthetic peptide directed towards the C-terminal region of GDF5. Synthetic peptide located within the following region: YLFSQRRKRRAPLATRQGKRPSKNLKARCSRKALHVNFKDMGWDDWIIAP

BMP14 / GDF5 (382-501, His-tag) human protein, 0.5 mg

Tag His-tag
Expression Host E. coli

BMP14 / GDF5 (382-501, His-tag) human protein, 0.1 mg

Tag His-tag
Expression Host E. coli

GDF5 HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB

Transient overexpression of GDF5 (NM_000557) in HEK293T cells paraffin embedded controls for ICC/IHC staining

USD 225.00

4 Weeks

Transient overexpression of GDF5 (NM_000557) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

Transient overexpression of GDF5 (NM_000557) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack