Germany
Japan
United Kingdom
China
GATA6 (Myc-DDK-tagged)-Human GATA binding protein 6 (GATA6)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Products
View as table Download
GATA6 (untagged)-Human GATA binding protein 6 (GATA6)
| Vector | pCMV6-XL6 |
| Tag | Tag Free |
| Mammalian Cell Selection | None |
Lenti ORF particles, GATA6 (Myc-DDK-tagged)-Human GATA binding protein 6 (GATA6), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
- LentiORF®
-
GATA6 (GFP-tagged) - Human GATA binding protein 6 (GATA6)
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti ORF particles, GATA6 (Myc-DDK-tagged)-Human GATA binding protein 6 (GATA6), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti-ORF clone of GATA6 (mGFP-tagged)-Human GATA binding protein 6 (GATA6)
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti-ORF clone of GATA6 (Myc-DDK-tagged)-Human GATA binding protein 6 (GATA6)
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
| Mammalian Cell Selection | None |
- LentiORF®
Lenti-ORF clone of GATA6 (Myc-DDK-tagged)-Human GATA binding protein 6 (GATA6)
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
GATA6 HEK293T cell transient overexpression lysate (as WB positive control)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
Lenti-ORF clone of GATA6 (mGFP-tagged)-Human GATA binding protein 6 (GATA6)
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
| Mammalian Cell Selection | None |
- LentiORF®
Rabbit Polyclonal anti-GATA6 antibody
| Applications | IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-GATA6 antibody: synthetic peptide directed towards the middle region of human GATA6. Synthetic peptide located within the following region: SGAGAPVMTGAGESTNPENSELKYSGQDGLYIGVSLASPAEVTSSVRPDS |
Rabbit Polyclonal Anti-GATA6 Antibody
| Applications | IF, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-GATA6 antibody: synthetic peptide directed towards the N terminal of human GATA6. Synthetic peptide located within the following region: PEEMYQTLAALSSQGPAAYDGAPGGFVHSAAAAAAAAAAASSPVYVPTTR |
Rabbit polyclonal anti-GATA6 antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from C-terminal of human GATA6. |
Mouse Monoclonal GATA6 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Rabbit anti GATA-6 Polyclonal Antibody
| Reactivities | Human |
| Conjugation | Unconjugated |
Anti-GATA6 Rabbit Polyclonal Antibody
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region derived from 9-23 amino acids of Human GATA binding protein 6 |
USD 420.00
4 Weeks
GATA6 Rabbit monoclonal antibody,clone OTIR5F2
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
GATA6 Rabbit monoclonal antibody,clone OTIR5F2
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
GATA6 Rabbit monoclonal antibody,clone OTIR5B8
| Applications | WB |
| Reactivities | Human, Rat |
| Conjugation | Unconjugated |
GATA6 Rabbit monoclonal antibody,clone OTIR5B8
| Applications | WB |
| Reactivities | Human, Rat |
| Conjugation | Unconjugated |
GATA6 Rabbit monoclonal antibody,clone OTIR3H6
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
GATA6 Rabbit monoclonal antibody,clone OTIR3H6
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Transient overexpression of GATA6 (NM_005257) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Purified recombinant protein of Human GATA binding protein 6 (GATA6), 300Leu-449Thr, with N-terminal His tag, expressed in E.coli, 50ug
| Tag | N-His |
| Expression Host | E. coli |
Transient overexpression of GATA6 (NM_005257) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of GATA6 (NM_005257) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Active filters
Target Symbol
- GATA6
Families
- Embryonic stem cells