Products

View as table Download

Lenti ORF clone of Human frizzled family receptor 5 (FZD5), mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF clone of Human frizzled family receptor 3 (FZD3), transcript variant 1, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, FZD3 (Myc-DDK tagged) - Human frizzled family receptor 3 (FZD3), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF clone of Human frizzled family receptor 3 (FZD3), transcript variant 1, mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, FZD3 (mGFP-tagged) - Human frizzled family receptor 3 (FZD3), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF clone of Human frizzled family receptor 4 (FZD4), mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF clone of Human frizzled family receptor 2 (FZD2), mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

FZD6 (Myc-DDK-tagged)-Human frizzled family receptor 6 (FZD6), transcript variant 3

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®

Lenti-ORF clone of FZD6 (Myc-DDK-tagged)-Human frizzled family receptor 6 (FZD6), transcript variant 3

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, FZD6 (Myc-DDK-tagged)-Human frizzled family receptor 6 (FZD6), transcript variant 3, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti-ORF clone of FZD6 (mGFP-tagged)-Human frizzled family receptor 6 (FZD6), transcript variant 3

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, FZD6 (mGFP-tagged)-Human frizzled family receptor 6 (FZD6), transcript variant 3, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF clone of Human frizzled family receptor 6 (FZD6), transcript variant 2, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, FZD6 (Myc-DDK tagged) - Human frizzled family receptor 6 (FZD6), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF clone of Human frizzled family receptor 6 (FZD6), transcript variant 2, mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, FZD6 (mGFP-tagged) - Human frizzled family receptor 6 (FZD6), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

FZD3 (GFP-tagged) - Human frizzled family receptor 3 (FZD3), transcript variant 1

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®

FZD6 (GFP-tagged) - Human frizzled family receptor 6 (FZD6), transcript variant 3

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®

FZD6 (GFP-tagged) - Human frizzled family receptor 6 (FZD6), transcript variant 2

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®

FZD3 (GFP-tagged) - Homo sapiens frizzled family receptor 3 (FZD3), transcript variant 2

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®

FZD9 (untagged)-Human frizzled family receptor 9 (FZD9)

Vector pCMV6-XL4
Tag Tag Free
Mammalian Cell Selection None

FZD5 (untagged)-Human frizzled family receptor 5 (FZD5)

Vector pCMV6-XL4
Tag Tag Free
Mammalian Cell Selection None

FZD3 (untagged)-Human frizzled family receptor 3 (FZD3), transcript variant 1

Vector pCMV6-XL5
Tag Tag Free
Mammalian Cell Selection None

FZD6 (untagged)-Human frizzled family receptor 6 (FZD6), transcript variant 1

Vector pCMV6-XL4
Tag Tag Free
Mammalian Cell Selection None

Rabbit Polyclonal Anti-FZD9 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-FZD9 antibody: synthetic peptide directed towards the N terminal of human FZD9. Synthetic peptide located within the following region: RPPGDLGPGAGGSGTCENPEKFQYVEKSRSCAPRCGPGVEVFWSRRDKDF

Frizzled 2 (FZD2) goat polyclonal antibody, Aff - Purified

Applications ELISA, IF, IHC, WB
Reactivities Human, Mouse, Rat
Immunogen Peptide with sequence from the internal region of the protein sequence according to NP_001457.1.

Rabbit polyclonal anti-FZD2 antibody

Applications IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human FZD2.

Rabbit polyclonal anti-FZD9 antibody

Applications IF, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from C-terminal of human FZD9.

Lenti ORF clone of Human frizzled family receptor 9 (FZD9), mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®