Rabbit Polyclonal CXCR4 Antibody
| Applications | FC, IF, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | CXCR4 antibody was raised against a peptide corresponding to 14 amino acids near the amino terminus of human CXCR4. The immunogen is located within the first 50 amino acids of CXCR4. |
Rabbit Polyclonal Anti-CXCR4 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CXCR4 Antibody: A synthesized peptide derived from human CXCR4 |
Rabbit polyclonal IL-8R beta/CDw128 beta (Ser347) antibody(Phospho-specific)
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human IL-8R beta/CDw128 beta around the phosphorylation site of serine 347 (R-P-SP-F-V). |
| Modifications | Phospho-specific |
Rabbit Polyclonal CXCR4 Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | CXCR4 antibody was raised against a 15 amino acid peptide near the center of human CXCR4. The immunogen is located within amino acids 170 - 220 of CXCR4. |
Rabbit polyclonal anti-ADRB1 antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human ADRB1 . |
Rabbit Polyclonal CCR5 (Ser336) Antibody (Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human CCR5 around the phosphorylation site of Serine 336 |
| Modifications | Phospho-specific |
Rabbit Polyclonal CCR5 Antibody
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human CCR5 |
Rabbit Polyclonal Anti-ADRB1 Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ADRB1 antibody: synthetic peptide directed towards the middle region of human ADRB1. Synthetic peptide located within the following region: CTVWAISALVSFLPILMHWWRAESDEARRCYNDPKCCDFVTNRAYAIASS |
Rabbit polyclonal CCR5 (Ser336) antibody(Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human CCR5 around the phosphorylation site of serine 336 (R-A-SP-S-V). |
| Modifications | Phospho-specific |
Rabbit Polyclonal IL-8R beta/CDw128 beta (Ser347) Antibody (Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human IL-8R beta/CDw128 beta around the phosphorylation site of Serine 347 |
| Modifications | Phospho-specific |
Anti-CXCR2 Rabbit Polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region derived from 18-39 amino acids of Human Chemokine (C-X-C motif) receptor 2 |
Anti-F2R Rabbit Polyclonal Antibody
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region derived from 56-70 amino acids of human coagulation factor II (thrombin) receptor |
Anti-ADRB2 Rabbit Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide peptide corresponding to a region derived from 21-33 amino acids of human adrenoceptor beta 2, surface |
Anti-ADRB3 Rabbit Polyclonal Antibody
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region derived from 21-33 amino acids of Human adrenoceptor beta 3 |
Germany
Japan
United Kingdom
China
