Products

cDNA Clones (11)
Antibodies (7)
Proteins (5)
Jump to Filters
View as table Download
CCR4 (NM_005508) Human Tagged ORF Clone
RC210003

USD 420.00

In Stock

CCR4 (Myc-DDK-tagged)-Human chemokine (C-C motif) receptor 4 (CCR4)

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
CCR4 (NM_005508) Human Untagged Clone
SC319943

USD 310.00

In Stock

CCR4 (untagged)-Human chemokine (C-C motif) receptor 4 (CCR4)

Vector pCMV6-AC
Tag Tag Free
Mammalian Cell Selection Neomycin
CCR4 (NM_005508) Human Tagged ORF Clone Lentiviral Particle
RC210003L1V

USD 820.00

3 Weeks

Lenti ORF particles, CCR4 (Myc-DDK tagged) - Human chemokine (C-C motif) receptor 4 (CCR4), 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
  • LentiORF®
CCR4 (NM_005508) Human Tagged ORF Clone Lentiviral Particle
RC210003L2V

USD 820.00

3 Weeks

Lenti ORF particles, CCR4 (mGFP-tagged) - Human chemokine (C-C motif) receptor 4 (CCR4), 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP
Tag mGFP
  • LentiORF®
CCR4 (NM_005508) Human Tagged ORF Clone
RC210003L3

USD 620.00

In Stock

Lenti ORF clone of Human chemokine (C-C motif) receptor 4 (CCR4), Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
CCR4 (NM_005508) Human Tagged ORF Clone
RC210003L4

USD 620.00

In Stock

Lenti ORF clone of Human chemokine (C-C motif) receptor 4 (CCR4), mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
CCR4 (NM_005508) Human Tagged ORF Clone
RG210003

USD 460.00

In Stock

CCR4 (GFP-tagged) - Human chemokine (C-C motif) receptor 4 (CCR4)

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
CCR4 (NM_005508) Human Tagged ORF Clone Lentiviral Particle
RC210003L3V

USD 820.00

3 Weeks

Lenti ORF particles, CCR4 (Myc-DDK tagged) - Human chemokine (C-C motif) receptor 4 (CCR4), 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
CCR4 (NM_005508) Human Tagged ORF Clone Lentiviral Particle
RC210003L4V

USD 820.00

3 Weeks

Lenti ORF particles, CCR4 (mGFP-tagged) - Human chemokine (C-C motif) receptor 4 (CCR4), 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
CCR4 (NM_005508) Human Tagged Lenti ORF Clone
RC210003L2

USD 768.00

In Stock

Lenti ORF clone of Human chemokine (C-C motif) receptor 4 (CCR4), mGFP tagged

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®
CCR4 Mouse Monoclonal Antibody [Clone ID: KH-4F5]
DM1232

USD 380.00

2 Weeks

CCR4 mouse monoclonal antibody, clone KH-4F5, Purified

Applications ELISA, FC, IF, WB
Reactivities Human
CCR4 (Extracell. Dom.) Goat Polyclonal Antibody
AP23074PU-N

USD 440.00

2 Weeks

CCR4 (Extracell. Dom.) goat polyclonal antibody, Aff - Purified

Applications ELISA, FC, IHC, WB
Reactivities Human, Monkey
Immunogen Synthetic corresponding to Human CCR4 extracellular domain.
Epitope: Extracellular Domain.
CCR4 (NM_005508) Human Tagged ORF Clone
RC210003L1

USD 620.00

In Stock

Lenti ORF clone of Human chemokine (C-C motif) receptor 4 (CCR4), Myc-DDK-tagged

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
Mammalian Cell Selection None
  • LentiORF®
CCR4 (NM_005508) Human Over-expression Lysate
LY401687

USD 396.00

5 Days

Transient overexpression lysate of chemokine (C-C motif) receptor 4 (CCR4)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
CCR4 Rabbit Polyclonal Antibody
TA317643

USD 425.00

In Stock

CCR4 Rabbit Polyclonal (C-Terminus) Antibody

Applications IHC
Reactivities Gibbon, Gorilla, Human
Conjugation Unconjugated
Immunogen CCR4 antibody was raised against synthetic 18 amino acid peptide from C-terminus of human CCR4. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon, Monkey (100%); Marmoset, Panda, Dog (94%); Hamster, Elephant, Bovine, Horse (89%); Bat, Rabbit, Opossum (83%).
CCR4 Rabbit Polyclonal Antibody
TA330377

USD 375.00

5 Days

Rabbit Polyclonal Anti-CCR4 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CCR4 antibody: synthetic peptide directed towards the middle region of human CCR4. Synthetic peptide located within the following region: TERNHTYCKTKYSLNSTTWKVLSSLEINILGLVIPLGIMLFCYSMIIRTL
CCR4 Rabbit Polyclonal Antibody
TA317657

USD 425.00

5 Days

CCR4 Rabbit Polyclonal (Extracellular Domain) Antibody

Applications IHC
Reactivities Human, Monkey, Gorilla, Gibbon
Conjugation Unconjugated
Immunogen CCR4 antibody was raised against synthetic 18 amino acid peptide from 2nd extracellular domain of human CCR4. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon, Monkey, Marmoset (100%); Ferret, Elephant, Panda (94%); Dog, Bovine, Bat, Hamster (89%); Mouse, Rat (83%).
CCR4 (NM_005508) Human Over-expression Lysate
LC401687

USD 121.00

In Stock

CCR4 HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
CCR4 Mouse Monoclonal Antibody
TA310022

USD 335.00

3 Weeks

Mouse anti-CCR4 monoclonal antibody

Applications IF
Reactivities Human
Conjugation Unconjugated
CCR4 Rabbit Polyclonal Antibody
AP26357PU-N

USD 355.00

3 Weeks

CCR4 rabbit polyclonal antibody, Aff - Purified

Applications WB
Reactivities Canine, Human, Mouse
Immunogen Synthetic peptide surrounding amino acid 32 of human CCR4
CCR4 ICC Control Block
TB410003

USD 1,070.00

4 Weeks

Transient overexpression of CCR4 (NM_005508) in HEK293T cells paraffin embedded controls for ICC/IHC staining

CCR4 Cytosection
TS410003

USD 225.00

4 Weeks

Transient overexpression of CCR4 (NM_005508) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

CCR4 Cytosection
TS410003P5

USD 889.00

4 Weeks

Transient overexpression of CCR4 (NM_005508) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack