FZD2 (GFP-tagged) - Human frizzled family receptor 2 (FZD2)
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
- TrueORF®
FZD2 (GFP-tagged) - Human frizzled family receptor 2 (FZD2)
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
FZD2 (Myc-DDK-tagged)-Human frizzled family receptor 2 (FZD2)
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
USD 820.00
3 Weeks
Lenti ORF particles, FZD2 (Myc-DDK tagged) - Human frizzled family receptor 2 (FZD2), 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK |
Tag | Myc-DDK |
USD 820.00
6 Weeks
Lenti ORF particles, FZD2 (mGFP-tagged) - Human frizzled family receptor 2 (FZD2), 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP |
Tag | mGFP |
FZD2 (untagged)-Human frizzled family receptor 2 (FZD2)
Vector | pCMV6-XL4 |
Tag | Tag Free |
Mammalian Cell Selection | None |
Lenti ORF clone of Human frizzled family receptor 2 (FZD2), Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
USD 820.00
7 Weeks
Lenti ORF particles, FZD2 (Myc-DDK tagged) - Human frizzled family receptor 2 (FZD2), 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF clone of Human frizzled family receptor 2 (FZD2), mGFP tagged
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
USD 820.00
3 Weeks
Lenti ORF particles, FZD2 (mGFP-tagged) - Human frizzled family receptor 2 (FZD2), 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Frizzled 2 (FZD2) goat polyclonal antibody, Aff - Purified
Applications | ELISA, IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Immunogen | Peptide with sequence from the internal region of the protein sequence according to NP_001457.1. |
Rabbit polyclonal anti-FZD2 antibody
Applications | IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human FZD2. |
Rabbit Polyclonal Anti-FZD2 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-FZD2 antibody: synthetic peptide directed towards the N terminal of human FZD2. Synthetic peptide located within the following region: MRPRSALPRLLLPLLLLPAAGPAQFHGEKGISIPDHGFCQPISIPLCTDI |
Lenti ORF clone of Human frizzled family receptor 2 (FZD2), mGFP tagged
Vector | pLenti-C-mGFP |
Tag | mGFP |
Mammalian Cell Selection | None |
Frizzled 2 (FZD2) goat polyclonal antibody, Purified
Applications | ELISA, IHC |
Reactivities | Bovine, Canine, Equine, Hamster, Human, Monkey, Mouse, Porcine, Rat |
Immunogen | Synthetic peptide from the internal region of the human protein sequence according to NP_001457.1 |
Anti-FZD2 Rabbit Polyclonal Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide corresponding to a region derived from 188-200 amino acids of human frizzled family receptor 2 |
Frizzled 2 (FZD2) (C-term) rabbit polyclonal antibody, Aff - Purified
Applications | WB |
Reactivities | Human |
Immunogen | KLH conjugated synthetic peptide between 533-563 amino acids from the C-terminal region of Human FZD2 / Frizzled-2 |
Rabbit Polyclonal Anti-FZD2 Antibody (N-Terminus)
Applications | IHC |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | FSD2 / Frizzled 2 antibody was raised against synthetic 20 amino acid peptide from N-terminal extracellular domain of human Frizzled 2. Percent identity with other species by BLAST analysis: Human, Gorilla, Monkey, Mouse, Rat, Hamster, Elephant, Panda, Dog, Bovine, Horse, Rabbit, Pig, Platypus (100%); Opossum (95%); Turkey, Lizard, Newt (80%). |
Anti-FZD2 Rabbit Polyclonal Antibody
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide corresponding to a region derived from 188-190 amino acids of human led family receptor 2 |
Transient overexpression of FZD2 (NM_001466) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of FZD2 (NM_001466) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of FZD2 (NM_001466) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack