Products

cDNA Clones (17)
Proteins (7)
Antibodies (1)
Jump to Filters
View as table Download
GPR176 (NM_007223) Human Tagged ORF Clone Lentiviral Particle
RC220955L2V

USD 870.00

6 Weeks

Lenti ORF particles, GPR176 (mGFP-tagged)-Human G protein-coupled receptor 176 (GPR176), 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP
Tag mGFP
  • LentiORF®
GPR176 (NM_007223) Human Tagged ORF Clone
RC220955

USD 470.00

In Stock

GPR176 (Myc-DDK-tagged)-Human G protein-coupled receptor 176 (GPR176)

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
GPR176 (NM_001271854) Human Tagged ORF Clone
RC234325

USD 544.00

In Stock

GPR176 (Myc-DDK tagged) - Homo sapiens G protein-coupled receptor 176 (GPR176), transcript variant 2

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
GPR176 (NM_007223) Human Tagged ORF Clone
RC220955L4

USD 670.00

In Stock

Lenti-ORF clone of GPR176 (mGFP-tagged)-Human G protein-coupled receptor 176 (GPR176)

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
GPR176 (NM_007223) Human Tagged ORF Clone
RG220955

USD 520.00

In Stock

GPR176 (GFP-tagged) - Human G protein-coupled receptor 176 (GPR176)

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
GPR176 (NM_007223) Human Tagged ORF Clone Lentiviral Particle
RC220955L4V

USD 870.00

3 Weeks

Lenti ORF particles, GPR176 (mGFP-tagged)-Human G protein-coupled receptor 176 (GPR176), 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
GPR176 (NM_007223) Human Tagged ORF Clone
RC220955L3

USD 670.00

In Stock

Lenti-ORF clone of GPR176 (Myc-DDK-tagged)-Human G protein-coupled receptor 176 (GPR176)

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
GPR176 (NM_001271855) Human Tagged ORF Clone
RC234199

USD 420.00

5 Weeks

GPR176 (Myc-DDK tagged) - Homo sapiens G protein-coupled receptor 176 (GPR176), transcript variant 3

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
GPR176 (NM_001271855) Human Tagged ORF Clone
RG234199

USD 460.00

5 Weeks

GPR176 (GFP-tagged) - Homo sapiens G protein-coupled receptor 176 (GPR176), transcript variant 3

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
GPR176 (NM_001271854) Human Tagged ORF Clone
RG234325

USD 530.00

5 Weeks

GPR176 (GFP-tagged) - Homo sapiens G protein-coupled receptor 176 (GPR176), transcript variant 2

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
GPR176 (NM_007223) Human Untagged Clone
SC115645

USD 870.00

In Stock

GPR176 (untagged)-Human G protein-coupled receptor 176 (GPR176)

Vector pCMV6-XL4
Tag Tag Free
Mammalian Cell Selection None
GPR176 (NM_007223) Human Tagged ORF Clone
RC220955L1

USD 670.00

In Stock

Lenti-ORF clone of GPR176 (Myc-DDK-tagged)-Human G protein-coupled receptor 176 (GPR176)

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
Mammalian Cell Selection None
  • LentiORF®
GPR176 (NM_007223) Human Tagged ORF Clone
RC220955L2

USD 670.00

3 Weeks

Lenti-ORF clone of GPR176 (mGFP-tagged)-Human G protein-coupled receptor 176 (GPR176)

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®
GPR176 Rabbit Polyclonal Antibody
TA337329

USD 375.00

5 Days

Rabbit Polyclonal Anti-GPR176 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-GPR176 antibody is: synthetic peptide directed towards the C-terminal region of Human GPR176. Synthetic peptide located within the following region: LEPSIRSGSQLLEMFHIGQQQIFKPTEDEEESEAKYIGSADFQAKEIFST
GPR176 (NM_001271854) Human Untagged Clone
SC333141

USD 520.00

5 Weeks

GPR176 (untagged) - Homo sapiens G protein-coupled receptor 176 (GPR176), transcript variant 2

Vector pCMV6 series
Tag Tag Free
GPR176 (NM_001271855) Human Untagged Clone
SC333142

USD 470.00

5 Weeks

GPR176 (untagged) - Homo sapiens G protein-coupled receptor 176 (GPR176), transcript variant 3

Vector pCMV6 series
Tag Tag Free
GPR176 (NM_007223) ICC Control Block
TB420955

USD 1,120.00

4 Weeks

Transient overexpression of GPR176 (NM_007223) in HEK293T cells paraffin embedded controls for ICC/IHC staining

GPR176 (NM_001271855) ICC Control Block
TB434199

USD 1,070.00

4 Weeks

Transient overexpression of GPR176 (NM_001271855) in HEK293T cells paraffin embedded controls for ICC/IHC staining

GPR176 (NM_001271854) ICC Control Block
TB434325

USD 1,130.00

4 Weeks

Transient overexpression of GPR176 (NM_001271854) in HEK293T cells paraffin embedded controls for ICC/IHC staining

GPR176 Cytosection
TS420955

USD 225.00

4 Weeks

Transient overexpression of GPR176 (NM_007223) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

GPR176 Cytosection
TS420955P5

USD 889.00

4 Weeks

Transient overexpression of GPR176 (NM_007223) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack

GPR176 ICC Control Sections
TS434199P5

USD 889.00

4 Weeks

Transient overexpression of GPR176 (NM_001271855) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack

GPR176 ICC Control Sections
TS434325P5

USD 889.00

4 Weeks

Transient overexpression of GPR176 (NM_001271854) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack