HTR2C (Myc-DDK-tagged)-Human 5-hydroxytryptamine (serotonin) receptor 2C (HTR2C)
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
HTR2C (Myc-DDK-tagged)-Human 5-hydroxytryptamine (serotonin) receptor 2C (HTR2C)
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
Lenti ORF particles, HTR2C (Myc-DDK tagged) - Human 5-hydroxytryptamine (serotonin) receptor 2C (HTR2C), 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK |
Tag | Myc-DDK |
Lenti ORF particles, HTR2C (mGFP-tagged) - Human 5-hydroxytryptamine (serotonin) receptor 2C (HTR2C), 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP |
Tag | mGFP |
HTR2C (GFP-tagged) - Homo sapiens 5-hydroxytryptamine (serotonin) receptor 2C, G protein-coupled (HTR2C), transcript variant 1
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
HTR2C (Myc-DDK tagged) - Homo sapiens 5-hydroxytryptamine (serotonin) receptor 2C, G protein-coupled (HTR2C), transcript variant 1
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
Lenti ORF clone of Human 5-hydroxytryptamine (serotonin) receptor 2C (HTR2C), Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, HTR2C (Myc-DDK tagged) - Human 5-hydroxytryptamine (serotonin) receptor 2C (HTR2C), 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF clone of Human 5-hydroxytryptamine (serotonin) receptor 2C (HTR2C), mGFP tagged
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, HTR2C (mGFP-tagged) - Human 5-hydroxytryptamine (serotonin) receptor 2C (HTR2C), 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
HTR2C (Myc-DDK tagged) - Homo sapiens 5-hydroxytryptamine (serotonin) receptor 2C, G protein-coupled (HTR2C), transcript variant 3
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
HTR2C (GFP-tagged) - Human 5-hydroxytryptamine (serotonin) receptor 2C (HTR2C)
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
HTR2C (GFP-tagged) - Homo sapiens 5-hydroxytryptamine (serotonin) receptor 2C, G protein-coupled (HTR2C), transcript variant 3
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
HTR2C (untagged)-Human 5-hydroxytryptamine (serotonin) receptor 2C (HTR2C)
Vector | pCMV6-XL4 |
Tag | Tag Free |
Mammalian Cell Selection | None |
Lenti ORF clone of Human 5-hydroxytryptamine (serotonin) receptor 2C (HTR2C), Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK |
Tag | Myc-DDK |
Mammalian Cell Selection | None |
HTR2C rabbit polyclonal antibody, Aff - Purified
Applications | ELISA, IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Immunogen | Synthetic peptide, corresponding to amino acids 400-450 of Human SR-2C. |
Rabbit polyclonal anti-5-HT-2C antibody
Applications | IF, IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human 5-HT-2C. |
Transient overexpression lysate of 5-hydroxytryptamine (serotonin) receptor 2C (HTR2C)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
HTR2C rabbit polyclonal antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Lenti ORF clone of Human 5-hydroxytryptamine (serotonin) receptor 2C (HTR2C), mGFP tagged
Vector | pLenti-C-mGFP |
Tag | mGFP |
Mammalian Cell Selection | None |
HTR2C rabbit polyclonal antibody
Applications | IF, IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
HTR2C rabbit polyclonal antibody, Purified
Applications | IHC, WB |
Reactivities | Human |
Immunogen | Synthetic peptide containing a sequence corresponding to a region within amino acids 387 and 446 of Human 5HT2C Receptor. |
HTR2C HEK293T cell transient overexpression lysate (as WB positive control)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
Goat Polyclonal Antibody against HTR2C
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence C-QVENLELPVN, from the internal region of the protein sequence according to NP_000859.1. |
Rabbit Polyclonal Anti-HTR2C Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-HTR2C antibody: synthetic peptide directed towards the N terminal of human HTR2C. Synthetic peptide located within the following region: SPVAAIVTDIFNTSDGGRFKFPDGVQNWPALSIVIIIIMTIGGNILVIMA |
HTR2C (untagged) - Homo sapiens 5-hydroxytryptamine (serotonin) receptor 2C, G protein-coupled (HTR2C), transcript variant 1
Vector | pCMV6 series |
Tag | Tag Free |
HTR2C (untagged) - Homo sapiens 5-hydroxytryptamine (serotonin) receptor 2C, G protein-coupled (HTR2C), transcript variant 3
Vector | pCMV6 series |
Tag | Tag Free |
Rabbit Polyclonal Anti-HTR2C Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human HTR2C |
Transient overexpression of HTR2C (NM_000868) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of HTR2C (NM_001256761) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of HTR2C (NM_001256760) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of HTR2C (NM_000868) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of HTR2C (NM_000868) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Transient overexpression of HTR2C (NM_001256761) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Transient overexpression of HTR2C (NM_001256760) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of HTR2C (NM_001256760) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack