Germany
Japan
United Kingdom
China
P2RY14 (Myc-DDK-tagged)-Human purinergic receptor P2Y, G-protein coupled, 14 (P2RY14), transcript variant 2
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
Products
View as table Download
P2RY14 (Myc-DDK-tagged)-Human purinergic receptor P2Y, G-protein coupled, 14 (P2RY14), transcript variant 1
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
USD 820.00
3 Weeks
Lenti ORF particles, P2RY14 (Myc-DDK tagged) - Human purinergic receptor P2Y, G-protein coupled, 14 (P2RY14), transcript variant 2, 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
- LentiORF®
-
USD 820.00
6 Weeks
Lenti ORF particles, P2RY14 (mGFP-tagged) - Human purinergic receptor P2Y, G-protein coupled, 14 (P2RY14), transcript variant 2, 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
- LentiORF®
-
USD 820.00
6 Weeks
Lenti ORF particles, P2RY14 (Myc-DDK tagged) - Human purinergic receptor P2Y, G-protein coupled, 14 (P2RY14), transcript variant 1, 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
- LentiORF®
-
USD 820.00
3 Weeks
Lenti ORF particles, P2RY14 (mGFP-tagged) - Human purinergic receptor P2Y, G-protein coupled, 14 (P2RY14), transcript variant 1, 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
- LentiORF®
-
P2RY14 (GFP-tagged) - Human purinergic receptor P2Y, G-protein coupled, 14 (P2RY14), transcript variant 2
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
P2RY14 (GFP-tagged) - Human purinergic receptor P2Y, G-protein coupled, 14 (P2RY14), transcript variant 1
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti ORF clone of Human purinergic receptor P2Y, G-protein coupled, 14 (P2RY14), transcript variant 2, Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
USD 820.00
5 Weeks
Lenti ORF particles, P2RY14 (Myc-DDK tagged) - Human purinergic receptor P2Y, G-protein coupled, 14 (P2RY14), transcript variant 2, 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human purinergic receptor P2Y, G-protein coupled, 14 (P2RY14), transcript variant 2, mGFP tagged
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
USD 820.00
7 Weeks
Lenti ORF particles, P2RY14 (mGFP-tagged) - Human purinergic receptor P2Y, G-protein coupled, 14 (P2RY14), transcript variant 2, 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human purinergic receptor P2Y, G-protein coupled, 14 (P2RY14), transcript variant 1, Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
USD 820.00
7 Weeks
Lenti ORF particles, P2RY14 (Myc-DDK tagged) - Human purinergic receptor P2Y, G-protein coupled, 14 (P2RY14), transcript variant 1, 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human purinergic receptor P2Y, G-protein coupled, 14 (P2RY14), transcript variant 1, mGFP tagged
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
USD 820.00
7 Weeks
Lenti ORF particles, P2RY14 (mGFP-tagged) - Human purinergic receptor P2Y, G-protein coupled, 14 (P2RY14), transcript variant 1, 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
P2RY14 (untagged)-Human purinergic receptor P2Y, G-protein coupled, 14 (P2RY14), transcript variant 2
| Vector | pCMV6-XL5 |
| Tag | Tag Free |
| Mammalian Cell Selection | None |
Lenti ORF clone of Human purinergic receptor P2Y, G-protein coupled, 14 (P2RY14), transcript variant 2, Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
| Mammalian Cell Selection | None |
- LentiORF®
P2RY14 (untagged)-Human purinergic receptor P2Y, G-protein coupled, 14 (P2RY14), transcript variant 1
| Vector | pCMV6-Entry |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
Transient overexpression lysate of purinergic receptor P2Y, G-protein coupled, 14 (P2RY14), transcript variant 1
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Lenti ORF clone of Human purinergic receptor P2Y, G-protein coupled, 14 (P2RY14), transcript variant 2, mGFP tagged
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
| Mammalian Cell Selection | None |
- LentiORF®
Lenti ORF clone of Human purinergic receptor P2Y, G-protein coupled, 14 (P2RY14), transcript variant 1, Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
| Mammalian Cell Selection | None |
- LentiORF®
P2RY14 HEK293T cell transient overexpression lysate (as WB positive control)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Rabbit Polyclonal Anti-P2Y14 Receptor (extracellular)
| Applications | WB |
| Reactivities | Human, Rat |
| Conjugation | Unconjugated |
| Immunogen | Peptide CIELKSELGRKWHKASN, corresponding to amino acid residues 172-188 of human P2Y14. 2nd extracellular loop. |
Rabbit Polyclonal Anti-P2RY14 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-P2RY14 antibody is: synthetic peptide directed towards the C-terminal region of Human P2RY14. Synthetic peptide located within the following region: YTKSQTEAHYSCQSKEILRYMKEFTLLLSAANVCLDPIIYFFLCQPFREI |
Rabbit Polyclonal Anti-P2RY14 Antibody (Extracellular Domain)
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | P2RY14 / GPR105 antibody was raised against synthetic 16 amino acid peptide from 2nd extracellular domain of human P2RY14 / P2Y14. Percent identity with other species by BLAST analysis: Human (100%); Monkey, Marmoset, Mouse (94%); Rat, Hamster, Panda, Dog, Bat, Rabbit, Pig (88%); Bovine, Horse (81%). |
P2RY14 HEK293T cell transient overexpression lysate (as WB positive control)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Transient overexpression lysate of purinergic receptor P2Y, G-protein coupled, 14 (P2RY14), transcript variant 2
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
P2RY14 Antibody - C-terminal region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Transient overexpression of P2RY14 (NM_014879) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of P2RY14 (NM_001081455) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of P2RY14 (NM_014879) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of P2RY14 (NM_014879) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Transient overexpression of P2RY14 (NM_001081455) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of P2RY14 (NM_001081455) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Active filters
Target Symbol
- P2RY14
Families
- GPCR