Germany
Japan
United Kingdom
China
CHRNB3 (Myc-DDK-tagged)-Human cholinergic receptor, nicotinic, beta 3 (CHRNB3)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Products
View as table DownloadLenti ORF particles, CHRNB3 (Myc-DDK tagged) - Human cholinergic receptor, nicotinic, beta 3 (CHRNB3), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
- LentiORF®
-
Lenti ORF particles, CHRNB3 (mGFP-tagged) - Human cholinergic receptor, nicotinic, beta 3 (CHRNB3), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
- LentiORF®
-
CHRNB3 (GFP-tagged) - Human cholinergic receptor, nicotinic, beta 3 (CHRNB3)
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti ORF clone of Human cholinergic receptor, nicotinic, beta 3 (CHRNB3), Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, CHRNB3 (Myc-DDK tagged) - Human cholinergic receptor, nicotinic, beta 3 (CHRNB3), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human cholinergic receptor, nicotinic, beta 3 (CHRNB3), mGFP tagged
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, CHRNB3 (mGFP-tagged) - Human cholinergic receptor, nicotinic, beta 3 (CHRNB3), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human cholinergic receptor, nicotinic, beta 3 (CHRNB3), Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
| Mammalian Cell Selection | None |
- LentiORF®
CHRNB3 (untagged)-Human cholinergic receptor, nicotinic, beta 3 (CHRNB3)
| Vector | pCMV6-XL5 |
| Tag | Tag Free |
| Mammalian Cell Selection | None |
Lenti ORF clone of Human cholinergic receptor, nicotinic, beta 3 (CHRNB3), mGFP tagged
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
| Mammalian Cell Selection | None |
- LentiORF®
Goat Polyclonal Antibody against CHRNB3
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-SRHVKKEHFISQ, from the internal region of the protein sequence according to NP_000740.1. |
Rabbit Polyclonal Anti-CHRNB3 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CHRNB3 antibody: synthetic peptide directed towards the middle region of human CHRNB3. Synthetic peptide located within the following region: YDGTMVDLILINENVDRKDFFDNGEWEILNAKGMKGNRRDGVYSYPFITY |
Transient overexpression of CHRNB3 (NM_000749) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of CHRNB3 (NM_000749) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of CHRNB3 (NM_000749) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Active filters
Target Symbol
- CHRNB3
Families
- Ion Channels: Cys-loop Receptors