Germany
Japan
United Kingdom
China
CHRNB3 (Myc-DDK-tagged)-Human cholinergic receptor, nicotinic, beta 3 (CHRNB3)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Products
View as table DownloadLenti ORF particles, CHRNB3 (Myc-DDK tagged) - Human cholinergic receptor, nicotinic, beta 3 (CHRNB3), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
- LentiORF®
-
Lenti ORF particles, CHRNB3 (mGFP-tagged) - Human cholinergic receptor, nicotinic, beta 3 (CHRNB3), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
- LentiORF®
-
Chrnb3 (Myc-DDK-tagged) - Mouse cholinergic receptor, nicotinic, beta polypeptide 3 (Chrnb3), transcript variant 1
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Chrnb3 (Myc-DDK-tagged) - Mouse cholinergic receptor, nicotinic, beta polypeptide 3 (Chrnb3), transcript variant 2
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
CHRNB3 (GFP-tagged) - Human cholinergic receptor, nicotinic, beta 3 (CHRNB3)
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
CHRNB3 - KN2.0, Human gene knockout kit via CRISPR, non-homology mediated.
| Format | 2 gRNA vectors, 1 linear donor |
| Donor DNA | EF1a-GFP-P2A-Puro |
KN410221 is the updated version of KN210221.
Chrnb3 - KN2.0, Mouse gene knockout kit via CRISPR, non-homology mediated.
| Format | 2 gRNA vectors, 1 linear donor |
| Donor DNA | EF1a-GFP-P2A-Puro |
KN503314 is the updated version of KN303314.
Chrnb3 (GFP-tagged) - Mouse cholinergic receptor, nicotinic, beta polypeptide 3 (cDNA clone MGC:67663 IMAGE:5357762)
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Chrnb3 (GFP-tagged) - Mouse cholinergic receptor nicotinic beta polypeptide 3 (Chrnb3) transcript variant 2, (10ug)
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti ORF clone of Chrnb3 (Myc-DDK-tagged) - Mouse cholinergic receptor, nicotinic, beta polypeptide 3 (Chrnb3), transcript variant 1
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Chrnb3 (Myc-DDK-tagged) - Mouse cholinergic receptor, nicotinic, beta polypeptide 3 (Chrnb3), transcript variant 1, 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Chrnb3 (mGFP-tagged) - Mouse cholinergic receptor, nicotinic, beta polypeptide 3 (Chrnb3), transcript variant 1
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Chrnb3 (GFP-tagged) - Mouse cholinergic receptor, nicotinic, beta polypeptide 3 (Chrnb3), transcript variant 1, 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Chrnb3 (Myc-DDK-tagged) - Mouse cholinergic receptor, nicotinic, beta polypeptide 3 (Chrnb3), transcript variant 2
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Chrnb3 (Myc-DDK-tagged) - Mouse cholinergic receptor, nicotinic, beta polypeptide 3 (Chrnb3), transcript variant 2, 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Chrnb3 (mGFP-tagged) - Mouse cholinergic receptor, nicotinic, beta polypeptide 3 (Chrnb3), transcript variant 2
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Chrnb3 (GFP-tagged) - Mouse cholinergic receptor, nicotinic, beta polypeptide 3 (Chrnb3), transcript variant 2, 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human cholinergic receptor, nicotinic, beta 3 (CHRNB3), Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, CHRNB3 (Myc-DDK tagged) - Human cholinergic receptor, nicotinic, beta 3 (CHRNB3), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human cholinergic receptor, nicotinic, beta 3 (CHRNB3), mGFP tagged
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, CHRNB3 (mGFP-tagged) - Human cholinergic receptor, nicotinic, beta 3 (CHRNB3), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Chrnb3 (Myc-DDK-tagged ORF) - Rat cholinergic receptor, nicotinic, beta 3 (Chrnb3), (10 ug)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti ORF clone of Chrnb3 (Myc-DDK-tagged ORF) - Rat cholinergic receptor, nicotinic, beta 3 (Chrnb3), (10 ug)
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Chrnb3 (Myc-DDK-tagged ORF) - Rat cholinergic receptor, nicotinic, beta 3 (Chrnb3), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Chrnb3 (mGFP-tagged ORF) - Rat cholinergic receptor, nicotinic, beta 3 (Chrnb3), (10 ug)
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Chrnb3 (GFP-tagged ORF) - Rat cholinergic receptor, nicotinic, beta 3 (Chrnb3), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human cholinergic receptor, nicotinic, beta 3 (CHRNB3), Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
| Mammalian Cell Selection | None |
- LentiORF®
CHRNB3 (untagged)-Human cholinergic receptor, nicotinic, beta 3 (CHRNB3)
| Vector | pCMV6-XL5 |
| Tag | Tag Free |
| Mammalian Cell Selection | None |
Chrnb3 (untagged) - Mouse cholinergic receptor, nicotinic, beta polypeptide 3 (Chrnb3), transcript variant 1, (10ug)
| Vector | PCMV6-Kan/Neo |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
Lenti ORF clone of Human cholinergic receptor, nicotinic, beta 3 (CHRNB3), mGFP tagged
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
| Mammalian Cell Selection | None |
- LentiORF®
Chrnb3 (untagged ORF) - Rat cholinergic receptor, nicotinic, beta 3 (Chrnb3), (10 ug)
| Vector | pCMV6-Entry2 |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
CHRNB3 (Human) - 3 unique 27mer siRNA duplexes - 2 nmol each
| Purity | HPLC purified |
| Number of Transfections | Approximately 330 transfections/2nmol in 24-well plate under optimized conditions (final conc. 10 nM). |
Special offer: Get $100/€100 off this product. Use code: SR100
Goat Polyclonal Antibody against CHRNB3
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-SRHVKKEHFISQ, from the internal region of the protein sequence according to NP_000740.1. |
Rabbit Polyclonal Anti-CHRNB3 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CHRNB3 antibody: synthetic peptide directed towards the middle region of human CHRNB3. Synthetic peptide located within the following region: YDGTMVDLILINENVDRKDFFDNGEWEILNAKGMKGNRRDGVYSYPFITY |
CHRNB3 CRISPRa kit - CRISPR gene activation of human cholinergic receptor nicotinic beta 3 subunit
| Format | 3gRNAs, 1 scramble ctrl and 1 enhancer vector |
Chrnb3 CRISPRa kit - CRISPR gene activation of mouse cholinergic receptor, nicotinic, beta polypeptide 3
| Format | 3gRNAs, 1 scramble ctrl and 1 enhancer vector |
qPCR primer pairs and template standards against Homo sapiens gene CHRNB3
| Application | Plasmid of exact quantity for transcript copy number calculation |
qSTAR qPCR primer pairs against Homo sapiens gene CHRNB3
| Component | 1 vial of lyophilized qSTAR qPCR primer mix (1 nmol each primer, sufficient for 200 reactions) |
qPCR primer pairs and template standards against Mus musculus gene Chrnb3
| Application | Plasmid of exact quantity for transcript copy number calculation |
qSTAR qPCR primer pairs against Mus musculus gene Chrnb3
Chrnb3 (Mouse) - 3 unique 27mer siRNA duplexes - 2 nmol each
| Purity | HPLC purified |
| Number of Transfections | Approximately 330 transfections/2nmol in 24-well plate under optimized conditions (final conc. 10 nM). |
SR426887 is the updated version of SR415049.
Chrnb3 (Rat) - 3 unique 27mer siRNA duplexes - 2 nmol each
| Purity | HPLC purified |
| Number of Transfections | Approximately 330 transfections/2nmol in 24-well plate under optimized conditions (final conc. 10 nM). |
Special offer: Get $100/€100 off this product. Use code: SR100
CHRNB3 Antibody - N-terminal region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the N-terminal region of Human ACHB3 |
CHRNB3 Antibody - middle region
| Applications | WB |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the middle region of mouse CHRNB3 |
CHRNB3 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 25-232 of human CHRNB3 (NP_000740.1). |
| Modifications | Unmodified |
Transient overexpression of CHRNB3 (NM_000749) in HEK293T cells paraffin embedded controls for ICC/IHC staining
CHRNB3 - Human, 4 unique 29mer shRNA constructs in lentiviral GFP vector
| Format | Lentiviral plasmids |
| Vector | pGFP-C-shLenti |
| E. coli Selection | Chloramphenicol |
| Mammalian Cell Selection | Puromycin |
CHRNB3 - Human shRNA lentiviral particles (4 unique 29mer target-specific shRNA, 1 scramble control), 0.5 ml each, >10^7 TU/ml.
| Format | Lentiviral particles |
| Vector | pGFP-C-shLenti |
Chrnb3 - Mouse, 4 unique 29mer shRNA constructs in lentiviral GFP vector
| Format | Lentiviral plasmids |
| Vector | pGFP-C-shLenti |
Active filters
Target Symbol
- CHRNB3