Germany
Japan
United Kingdom
China
CLCN1 (Myc-DDK-tagged)-Human chloride channel 1, skeletal muscle (CLCN1)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
Products
View as table Download
Lenti ORF particles, CLCN1 (Myc-DDK tagged) - Human chloride channel 1, skeletal muscle (CLCN1), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
- LentiORF®
-
Lenti ORF particles, CLCN1 (mGFP-tagged) - Human chloride channel 1, skeletal muscle (CLCN1), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
- LentiORF®
-
Lenti ORF clone of Human chloride channel 1, skeletal muscle (CLCN1), Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, CLCN1 (Myc-DDK tagged) - Human chloride channel 1, skeletal muscle (CLCN1), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human chloride channel 1, skeletal muscle (CLCN1), mGFP tagged
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, CLCN1 (mGFP-tagged) - Human chloride channel 1, skeletal muscle (CLCN1), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
CLCN1 (GFP-tagged) - Human chloride channel 1, skeletal muscle (CLCN1)
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti ORF clone of Human chloride channel 1, skeletal muscle (CLCN1), Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
| Mammalian Cell Selection | None |
- LentiORF®
Transient overexpression lysate of chloride channel 1, skeletal muscle (CLCN1)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
CLCN1 (untagged)-Human chloride channel 1, skeletal muscle (CLCN1)
| Vector | pCMV6-XL5 |
| Tag | Tag Free |
| Mammalian Cell Selection | None |
Rabbit anti-CLCN1 Polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human CLCN1 |
Lenti ORF clone of Human chloride channel 1, skeletal muscle (CLCN1), mGFP tagged
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
| Mammalian Cell Selection | None |
- LentiORF®
CLCN1 HEK293T cell transient overexpression lysate (as WB positive control)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Rabbit Polyclonal Anti-Clcn1 Antibody
| Applications | WB |
| Reactivities | Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Clcn1 antibody: synthetic peptide corresponding to a region of Rat. Synthetic peptide located within the following region: SSIFQRLLHCLLGKAHSTKKKITQDSTDLVDNMSPEEIEAWEREQLSQPV |
Transient overexpression of CLCN1 (NM_000083) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of CLCN1 (NM_000083) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of CLCN1 (NM_000083) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Active filters
Target Symbol
- CLCN1
Families
- Ion Channels: Other