Germany
Japan
United Kingdom
China
CLIC2 (Myc-DDK-tagged)-Human chloride intracellular channel 2 (CLIC2)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
Products
View as table Download
Recombinant protein of human chloride intracellular channel 2 (CLIC2)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
Special Offer: Get a 20% discount on this product. Use code: "MVPro20".
Lenti ORF particles, CLIC2 (Myc-DDK tagged) - Human chloride intracellular channel 2 (CLIC2), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
- LentiORF®
-
Lenti ORF particles, CLIC2 (mGFP-tagged) - Human chloride intracellular channel 2 (CLIC2), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
- LentiORF®
-
CLIC2 (GFP-tagged) - Human chloride intracellular channel 2 (CLIC2)
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti ORF clone of Human chloride intracellular channel 2 (CLIC2), Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, CLIC2 (Myc-DDK tagged) - Human chloride intracellular channel 2 (CLIC2), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human chloride intracellular channel 2 (CLIC2), mGFP tagged
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, CLIC2 (mGFP-tagged) - Human chloride intracellular channel 2 (CLIC2), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human chloride intracellular channel 2 (CLIC2), Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
| Mammalian Cell Selection | None |
- LentiORF®
Transient overexpression lysate of chloride intracellular channel 2 (CLIC2)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Lenti ORF clone of Human chloride intracellular channel 2 (CLIC2), mGFP tagged
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
| Mammalian Cell Selection | None |
- LentiORF®
CLIC2 HEK293T cell transient overexpression lysate (as WB positive control)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
CLIC2 (untagged)-Human chloride intracellular channel 2 (CLIC2)
| Vector | pCMV6-XL5 |
| Tag | Tag Free |
| Mammalian Cell Selection | None |
CLIC2 (untagged)-Human chloride intracellular channel 2 (CLIC2)
| Vector | pCMV6-XL5 |
| Tag | Tag Free |
| Mammalian Cell Selection | None |
Rabbit Polyclonal Anti-CLIC2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CLIC2 antibody: synthetic peptide directed towards the C terminal of human CLIC2. Synthetic peptide located within the following region: SAEEPPVSRRLFLDGDQLTLADCSLLPKLNIIKVAAKKYRDFDIPAEFSG |
Rabbit Polyclonal Anti-CLIC2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CLIC2 antibody: synthetic peptide directed towards the middle region of human CLIC2. Synthetic peptide located within the following region: HLSPKYKESFDVGCNLFAKFSAYIKNTQKEANKNFEKSLLKEFKRLDDYL |
CLIC2 (1-247, His-tag) human recombinant protein, 0.5 mg
| Tag | His-tag |
| Expression Host | E. coli |
CLIC2 (1-247, His-tag) human recombinant protein, 0.1 mg
| Tag | His-tag |
| Expression Host | E. coli |
CLIC2 MS Standard C13 and N15-labeled recombinant protein (NP_001280)
| Tag | C-Myc/DDK |
| Expression Host | HEK293 |
Transient overexpression of CLIC2 (NM_001289) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Recombinant protein of human chloride intracellular channel 2 (CLIC2)
| Tag | N-His |
| Expression Host | E. coli |
Recombinant protein of human chloride intracellular channel 2 (CLIC2)
| Tag | N-His |
| Expression Host | E. coli |
Recombinant protein of human chloride intracellular channel 2 (CLIC2)
| Tag | N-His |
| Expression Host | E. coli |
Recombinant protein of human chloride intracellular channel 2 (CLIC2)
| Tag | N-His |
| Expression Host | E. coli |
Transient overexpression of CLIC2 (NM_001289) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of CLIC2 (NM_001289) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Active filters
Target Symbol
- CLIC2
Families
- Ion Channels: Other