CLIC2 (Myc-DDK-tagged)-Human chloride intracellular channel 2 (CLIC2)
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
CLIC2 (Myc-DDK-tagged)-Human chloride intracellular channel 2 (CLIC2)
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
Recombinant protein of human chloride intracellular channel 2 (CLIC2)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Special Offer: Get a 20% discount on this product. Use code: "MVPro20".
Lenti ORF particles, CLIC2 (Myc-DDK tagged) - Human chloride intracellular channel 2 (CLIC2), 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK |
Tag | Myc-DDK |
Lenti ORF particles, CLIC2 (mGFP-tagged) - Human chloride intracellular channel 2 (CLIC2), 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP |
Tag | mGFP |
CLIC2 (GFP-tagged) - Human chloride intracellular channel 2 (CLIC2)
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
CLIC2 - KN2.0, Human gene knockout kit via CRISPR, non-homology mediated.
Format | 2 gRNA vectors, 1 linear donor |
Donor DNA | EF1a-GFP-P2A-Puro |
Lenti ORF clone of Human chloride intracellular channel 2 (CLIC2), Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, CLIC2 (Myc-DDK tagged) - Human chloride intracellular channel 2 (CLIC2), 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF clone of Human chloride intracellular channel 2 (CLIC2), mGFP tagged
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, CLIC2 (mGFP-tagged) - Human chloride intracellular channel 2 (CLIC2), 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Clic2 (Myc-DDK-tagged ORF) - Rat chloride intracellular channel 2 (Clic2), (10 ug)
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
Lenti ORF clone of Clic2 (Myc-DDK-tagged ORF) - Rat chloride intracellular channel 2 (Clic2), (10 ug)
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, Clic2 (Myc-DDK-tagged ORF) - Rat chloride intracellular channel 2 (Clic2), 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF clone of Clic2 (mGFP-tagged ORF) - Rat chloride intracellular channel 2 (Clic2), (10 ug)
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, Clic2 (GFP-tagged ORF) - Rat chloride intracellular channel 2 (Clic2), 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti ORF clone of Human chloride intracellular channel 2 (CLIC2), Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK |
Tag | Myc-DDK |
Mammalian Cell Selection | None |
Transient overexpression lysate of chloride intracellular channel 2 (CLIC2)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
Lenti ORF clone of Human chloride intracellular channel 2 (CLIC2), mGFP tagged
Vector | pLenti-C-mGFP |
Tag | mGFP |
Mammalian Cell Selection | None |
CLIC2 HEK293T cell transient overexpression lysate (as WB positive control)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
CLIC2 (untagged)-Human chloride intracellular channel 2 (CLIC2)
Vector | pCMV6-XL5 |
Tag | Tag Free |
Mammalian Cell Selection | None |
CLIC2 (untagged)-Human chloride intracellular channel 2 (CLIC2)
Vector | pCMV6-XL5 |
Tag | Tag Free |
Mammalian Cell Selection | None |
Rabbit Polyclonal Anti-CLIC2 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-CLIC2 antibody: synthetic peptide directed towards the C terminal of human CLIC2. Synthetic peptide located within the following region: SAEEPPVSRRLFLDGDQLTLADCSLLPKLNIIKVAAKKYRDFDIPAEFSG |
Rabbit Polyclonal Anti-CLIC2 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-CLIC2 antibody: synthetic peptide directed towards the middle region of human CLIC2. Synthetic peptide located within the following region: HLSPKYKESFDVGCNLFAKFSAYIKNTQKEANKNFEKSLLKEFKRLDDYL |
CLIC2 (1-247, His-tag) human recombinant protein, 0.5 mg
Tag | His-tag |
Expression Host | E. coli |
CLIC2 (1-247, His-tag) human recombinant protein, 0.1 mg
Tag | His-tag |
Expression Host | E. coli |
CLIC2 CRISPRa kit - CRISPR gene activation of human chloride intracellular channel 2
Format | 3gRNAs, 1 scramble ctrl and 1 enhancer vector |
qPCR primer pairs and template standards against Homo sapiens gene CLIC2
Application | Plasmid of exact quantity for transcript copy number calculation |
qSTAR qPCR primer pairs against Homo sapiens gene CLIC2
Component | 1 vial of lyophilized qSTAR qPCR primer mix (1 nmol each primer, sufficient for 200 reactions) |
CLIC2 MS Standard C13 and N15-labeled recombinant protein (NP_001280)
Tag | C-Myc/DDK |
Expression Host | HEK293 |
Clic2 (untagged ORF) - Rat chloride intracellular channel 2 (Clic2), (10 ug)
Vector | pCMV6-Entry |
Tag | Tag Free |
Mammalian Cell Selection | Neomycin |
3`UTR clone of chloride intracellular channel 2 (CLIC2) for miRNA target validation
Vector | pMirTarget |
Mammalian Cell Selection | Neomycin |
Species | Human |
Transfection Reporter | RFP |
Assay Reporter | Luciferase |
CLIC2 (Human) - 3 unique 27mer siRNA duplexes - 2 nmol each
Purity | HPLC purified |
Number of Transfections | Approximately 330 transfections/2nmol in 24-well plate under optimized conditions (final conc. 10 nM). |
Special offer: Get $100/€100 off this product. Use code: SR100
Clic2 (Rat) - 3 unique 27mer siRNA duplexes - 2 nmol each
Purity | HPLC purified |
Number of Transfections | Approximately 330 transfections/2nmol in 24-well plate under optimized conditions (final conc. 10 nM). |
Special offer: Get $100/€100 off this product. Use code: SR100
CLIC2 Antibody - N-terminal region
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen is a synthetic peptide directed towards the N-terminal region of Human CLIC2 |
CLIC2 rabbit polyclonal antibody
Applications | IHC |
Reactivities | Human, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human CLIC2 |
CLIC2 rabbit polyclonal antibody
Applications | IHC |
Reactivities | Human, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human CLIC2 |
Transient overexpression of CLIC2 (NM_001289) in HEK293T cells paraffin embedded controls for ICC/IHC staining
CLIC2 - Human, 4 unique 29mer shRNA constructs in lentiviral GFP vector
Format | Lentiviral plasmids |
Vector | pGFP-C-shLenti |
E. coli Selection | Chloramphenicol |
Mammalian Cell Selection | Puromycin |
CLIC2 - Human shRNA lentiviral particles (4 unique 29mer target-specific shRNA, 1 scramble control), 0.5 ml each, >10^7 TU/ml.
Format | Lentiviral particles |
Vector | pGFP-C-shLenti |
Clic2 - Rat, 4 unique 29mer shRNA constructs in lentiviral GFP vector
Format | Lentiviral plasmids |
Vector | pGFP-C-shLenti |
Clic2 - Rat shRNA lentiviral particles (4 unique 29mer target-specific shRNA, 1 scramble control), 0.5 ml each, >10^7 TU/ml.
Format | Lentiviral particles |
Vector | pGFP-C-shLenti |
Recombinant protein of human chloride intracellular channel 2 (CLIC2)
Tag | N-His |
Expression Host | E. coli |
Recombinant protein of human chloride intracellular channel 2 (CLIC2)
Tag | N-His |
Expression Host | E. coli |
Recombinant protein of human chloride intracellular channel 2 (CLIC2)
Tag | N-His |
Expression Host | E. coli |
Recombinant protein of human chloride intracellular channel 2 (CLIC2)
Tag | N-His |
Expression Host | E. coli |
CLIC2 - Human, 4 unique 29mer shRNA constructs in retroviral untagged vector
Format | Retroviral plasmids |
Vector | pRS |
E. coli Selection | Ampicillin |
Mammalian Cell Selection | Puromycin |
Clic2 - Rat, 4 unique 29mer shRNA constructs in retroviral untagged vector
Format | Retroviral plasmids |
Vector | pRS |
Transient overexpression of CLIC2 (NM_001289) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of CLIC2 (NM_001289) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack