Germany
Japan
United Kingdom
China
GJC1 (Myc-DDK-tagged)-Human gap junction protein, gamma 1, 45kDa (GJC1), transcript variant 1
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Products
View as table DownloadLenti ORF particles, GJC1 (Myc-DDK-tagged)-Human gap junction protein, gamma 1, 45kDa (GJC1), transcript variant 1, 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
- LentiORF®
-
Lenti ORF particles, GJC1 (mGFP-tagged)-Human gap junction protein, gamma 1, 45kDa (GJC1), transcript variant 1, 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
- LentiORF®
-
GJC1 (Myc-DDK-tagged)-Human gap junction protein, gamma 1, 45kDa (GJC1), transcript variant 2
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
GJC1 (GFP-tagged) - Human gap junction protein, gamma 1, 45kDa (GJC1), transcript variant 1
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti-ORF clone of GJC1 (Myc-DDK-tagged)-Human gap junction protein, gamma 1, 45kDa (GJC1), transcript variant 1
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, GJC1 (Myc-DDK-tagged)-Human gap junction protein, gamma 1, 45kDa (GJC1), transcript variant 1, 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti-ORF clone of GJC1 (mGFP-tagged)-Human gap junction protein, gamma 1, 45kDa (GJC1), transcript variant 1
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, GJC1 (mGFP-tagged)-Human gap junction protein, gamma 1, 45kDa (GJC1), transcript variant 1, 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti-ORF clone of GJC1 (Myc-DDK-tagged)-Human gap junction protein, gamma 1, 45kDa (GJC1), transcript variant 2
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, GJC1 (Myc-DDK-tagged)-Human gap junction protein, gamma 1, 45kDa (GJC1), transcript variant 2, 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti-ORF clone of GJC1 (mGFP-tagged)-Human gap junction protein, gamma 1, 45kDa (GJC1), transcript variant 2
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, GJC1 (mGFP-tagged)-Human gap junction protein, gamma 1, 45kDa (GJC1), transcript variant 2, 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
GJC1 (GFP-tagged) - Human gap junction protein, gamma 1, 45kDa (GJC1), transcript variant 2
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti-ORF clone of GJC1 (Myc-DDK-tagged)-Human gap junction protein, gamma 1, 45kDa (GJC1), transcript variant 1
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
| Mammalian Cell Selection | None |
- LentiORF®
Lenti-ORF clone of GJC1 (mGFP-tagged)-Human gap junction protein, gamma 1, 45kDa (GJC1), transcript variant 1
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
| Mammalian Cell Selection | None |
- LentiORF®
GJC1 (untagged)-Human gap junction protein, gamma 1, 45kDa (GJC1), transcript variant 1
| Vector | pCMV6-XL4 |
| Tag | Tag Free |
| Mammalian Cell Selection | None |
GJC1 (untagged)-Human gap junction protein, gamma 1, 45kDa (GJC1), transcript variant 2
| Vector | pCMV6 series |
| Tag | Tag Free |
Rabbit Polyclonal Anti-GJC1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-GJC1 antibody: synthetic peptide directed towards the middle region of human GJC1. Synthetic peptide located within the following region: ERLDLAVQAYSHQNNPHGPREKKAKVGSKAGSNKSTASSKSGDGKTSVWI |
Rabbit Polyclonal Anti-GJC1 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide of human GJC1 |
Transient overexpression of GJC1 (NM_005497) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of GJC1 (NM_001080383) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of GJC1 (NM_005497) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of GJC1 (NM_005497) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Transient overexpression of GJC1 (NM_001080383) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of GJC1 (NM_001080383) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Active filters
Target Symbol
- GJC1
Families
- Ion Channels: Other