Products

View as table Download

GJC1 (Myc-DDK-tagged)-Human gap junction protein, gamma 1, 45kDa (GJC1), transcript variant 1

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®

Lenti ORF particles, GJC1 (Myc-DDK-tagged)-Human gap junction protein, gamma 1, 45kDa (GJC1), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
  • LentiORF®

Lenti ORF particles, GJC1 (mGFP-tagged)-Human gap junction protein, gamma 1, 45kDa (GJC1), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP
Tag mGFP
  • LentiORF®

Gjc1 (Myc-DDK-tagged) - Mouse gap junction protein, gamma 1 (Gjc1), transcript variant 1

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®

Gjc1 (Myc-DDK-tagged) - Mouse gap junction protein, gamma 1 (Gjc1), transcript variant 3

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®

GJC1 (Myc-DDK-tagged)-Human gap junction protein, gamma 1, 45kDa (GJC1), transcript variant 2

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®

Gjc1 (Myc-DDK-tagged) - Mouse gap junction protein, gamma 1 (Gjc1), transcript variant 2

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®

GJC1 (GFP-tagged) - Human gap junction protein, gamma 1, 45kDa (GJC1), transcript variant 1

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®

GJC1 - KN2.0, Human gene knockout kit via CRISPR, non-homology mediated.

Format 2 gRNA vectors, 1 linear donor
Donor DNA EF1a-GFP-P2A-Puro
KN411939 is the updated version of KN211939.

Gjc1 (GFP-tagged) - Mouse gap junction membrane channel protein alpha 7 (Gja7)

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®

Gjc1 (GFP-tagged) - Mouse gap junction protein gamma 1 (Gjc1) transcript variant 1, (10ug)

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®

Gjc1 (GFP-tagged) - Mouse gap junction protein gamma 1 (Gjc1) transcript variant 3, (10ug)

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®

Lenti ORF clone of Gjc1 (Myc-DDK-tagged) - Mouse gap junction protein, gamma 1 (Gjc1), transcript variant 2

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, Gjc1 (Myc-DDK-tagged) - Mouse gap junction protein, gamma 1 (Gjc1), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF clone of Gjc1 (mGFP-tagged) - Mouse gap junction protein, gamma 1 (Gjc1), transcript variant 2

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, Gjc1 (GFP-tagged) - Mouse gap junction protein, gamma 1 (Gjc1), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF clone of Gjc1 (Myc-DDK-tagged) - Mouse gap junction protein, gamma 1 (Gjc1), transcript variant 1

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, Gjc1 (Myc-DDK-tagged) - Mouse gap junction protein, gamma 1 (Gjc1), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF clone of Gjc1 (mGFP-tagged) - Mouse gap junction protein, gamma 1 (Gjc1), transcript variant 1

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, Gjc1 (GFP-tagged) - Mouse gap junction protein, gamma 1 (Gjc1), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF clone of Gjc1 (Myc-DDK-tagged) - Mouse gap junction protein, gamma 1 (Gjc1), transcript variant 3

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, Gjc1 (Myc-DDK-tagged) - Mouse gap junction protein, gamma 1 (Gjc1), transcript variant 3, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF clone of Gjc1 (mGFP-tagged) - Mouse gap junction protein, gamma 1 (Gjc1), transcript variant 3

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, Gjc1 (GFP-tagged) - Mouse gap junction protein, gamma 1 (Gjc1), transcript variant 3, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti-ORF clone of GJC1 (Myc-DDK-tagged)-Human gap junction protein, gamma 1, 45kDa (GJC1), transcript variant 1

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, GJC1 (Myc-DDK-tagged)-Human gap junction protein, gamma 1, 45kDa (GJC1), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti-ORF clone of GJC1 (mGFP-tagged)-Human gap junction protein, gamma 1, 45kDa (GJC1), transcript variant 1

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, GJC1 (mGFP-tagged)-Human gap junction protein, gamma 1, 45kDa (GJC1), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti-ORF clone of GJC1 (Myc-DDK-tagged)-Human gap junction protein, gamma 1, 45kDa (GJC1), transcript variant 2

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, GJC1 (Myc-DDK-tagged)-Human gap junction protein, gamma 1, 45kDa (GJC1), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti-ORF clone of GJC1 (mGFP-tagged)-Human gap junction protein, gamma 1, 45kDa (GJC1), transcript variant 2

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, GJC1 (mGFP-tagged)-Human gap junction protein, gamma 1, 45kDa (GJC1), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

GJC1 (GFP-tagged) - Human gap junction protein, gamma 1, 45kDa (GJC1), transcript variant 2

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®

Gja7 (Myc-DDK-tagged ORF) - Rat gap junction membrane channel protein alpha 7 (Gja7), (10 ug)

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®

Lenti ORF clone of Gja7 (Myc-DDK-tagged ORF) - Rat gap junction membrane channel protein alpha 7 (Gja7), (10 ug)

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, Gja7 (Myc-DDK-tagged ORF) - Rat gap junction membrane channel protein alpha 7 (Gja7), 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF clone of Gja7 (mGFP-tagged ORF) - Rat gap junction membrane channel protein alpha 7 (Gja7), (10 ug)

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, Gja7 (GFP-tagged ORF) - Rat gap junction membrane channel protein alpha 7 (Gja7), 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

GJC1 rabbit polyclonal antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human GJC1

Lenti-ORF clone of GJC1 (Myc-DDK-tagged)-Human gap junction protein, gamma 1, 45kDa (GJC1), transcript variant 1

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
Mammalian Cell Selection None
  • LentiORF®

Gjc1 (untagged) - Mouse gap junction protein, gamma 1 (Gjc1), transcript variant 3, (10ug)

Vector pCMV6-Entry
Tag Tag Free
Mammalian Cell Selection Neomycin

Lenti-ORF clone of GJC1 (mGFP-tagged)-Human gap junction protein, gamma 1, 45kDa (GJC1), transcript variant 1

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®

Gja7 (untagged ORF) - Rat gap junction membrane channel protein alpha 7 (Gja7), (10 ug)

Vector pCMV6-Entry
Tag Tag Free
Mammalian Cell Selection Neomycin

GJC1 (untagged)-Human gap junction protein, gamma 1, 45kDa (GJC1), transcript variant 1

Vector pCMV6-XL4
Tag Tag Free
Mammalian Cell Selection None

GJC1 rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human, Mouse, Rat

GJC1 (untagged)-Human gap junction protein, gamma 1, 45kDa (GJC1), transcript variant 2

Vector pCMV6 series
Tag Tag Free

Rabbit Polyclonal Anti-GJC1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-GJC1 antibody: synthetic peptide directed towards the middle region of human GJC1. Synthetic peptide located within the following region: ERLDLAVQAYSHQNNPHGPREKKAKVGSKAGSNKSTASSKSGDGKTSVWI

GJC1 CRISPRa kit - CRISPR gene activation of human gap junction protein gamma 1

Format 3gRNAs, 1 scramble ctrl and 1 enhancer vector

Gjc1 CRISPRa kit - CRISPR gene activation of mouse gap junction protein, gamma 1

Format 3gRNAs, 1 scramble ctrl and 1 enhancer vector

qPCR primer pairs and template standards against Homo sapiens gene GJC1

Application Plasmid of exact quantity for transcript copy number calculation