Germany
Japan
United Kingdom
China
KCTD17 (Myc-DDK-tagged)-Human potassium channel tetramerisation domain containing 17 (KCTD17)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
Products
View as table Download
Recombinant protein of human potassium channel tetramerisation domain containing 17 (KCTD17)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
KCTD17 (GFP-tagged) - Human potassium channel tetramerisation domain containing 17 (KCTD17)
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti ORF clone of Human potassium channel tetramerisation domain containing 17 (KCTD17), Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, KCTD17 (Myc-DDK tagged) - Human potassium channel tetramerisation domain containing 17 (KCTD17), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human potassium channel tetramerisation domain containing 17 (KCTD17), mGFP tagged
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, KCTD17 (mGFP-tagged) - Human potassium channel tetramerisation domain containing 17 (KCTD17), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
KCTD17 (myc-DDK-tagged) - Human potassium channel tetramerization domain containing 17 (KCTD17), transcript variant 4
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
KCTD17 (myc-DDK-tagged) - Human potassium channel tetramerization domain containing 17 (KCTD17), transcript variant 3
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
KCTD17 (myc-DDK-tagged) - Human potassium channel tetramerization domain containing 17 (KCTD17), transcript variant 1
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
KCTD17 (untagged)-Human potassium channel tetramerisation domain containing 17 (KCTD17)
| Vector | pCMV6-XL5 |
| Tag | Tag Free |
| Mammalian Cell Selection | None |
KCTD17 (untagged) - Human potassium channel tetramerization domain containing 17 (KCTD17), transcript variant 1
| Vector | pCMV6-Entry |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
Transient overexpression lysate of potassium channel tetramerisation domain containing 17 (KCTD17)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Special Offer: Get a 20% discount on this product. Use code: "OEL20".
Rabbit Polyclonal Anti-KCTD17 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-KCTD17 antibody: synthetic peptide directed towards the middle region of human KCTD17. Synthetic peptide located within the following region: YGSEDQAEFLCVVSKELHSTPNGLSSESSRKTKSTEEQLEEQQQQEEEVE |
KCTD17 HEK293T cell transient overexpression lysate (as WB positive control)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
KCTD17 MS Standard C13 and N15-labeled recombinant protein (NP_078957)
| Tag | C-Myc/DDK |
| Expression Host | HEK293 |
KCTD17 (GFP-tagged) - Human potassium channel tetramerization domain containing 17 (KCTD17), transcript variant 4
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
KCTD17 (GFP-tagged) - Human potassium channel tetramerization domain containing 17 (KCTD17), transcript variant 3
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
KCTD17 (GFP-tagged) - Human potassium channel tetramerization domain containing 17 (KCTD17), transcript variant 1
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
KCTD17 (untagged)-Human potassium channel tetramerisation domain containing 17 (KCTD17)
| Vector | pCMV6-Entry |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
KCTD17 (untagged) - Human potassium channel tetramerization domain containing 17 (KCTD17), transcript variant 4
| Vector | pCMV6-Entry |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
KCTD17 (untagged) - Human potassium channel tetramerization domain containing 17 (KCTD17), transcript variant 3
| Vector | pCMV6-Entry |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
Transient overexpression of KCTD17 (NM_024681) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of KCTD17 (NM_001282686) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of KCTD17 (NM_001282685) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of KCTD17 (NM_001282684) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of KCTD17 (NM_024681) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of KCTD17 (NM_024681) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Transient overexpression of KCTD17 (NM_001282686) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Transient overexpression of KCTD17 (NM_001282685) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Transient overexpression of KCTD17 (NM_001282684) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Active filters
Target Symbol
- KCTD17
Families
- Ion Channels: Other