VDAC3 (Myc-DDK-tagged)-Human voltage-dependent anion channel 3 (VDAC3), transcript variant 2
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
VDAC3 (Myc-DDK-tagged)-Human voltage-dependent anion channel 3 (VDAC3), transcript variant 2
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
VDAC3 (GFP-tagged) - Human voltage-dependent anion channel 3 (VDAC3), transcript variant 2
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
Lenti ORF particles, VDAC3 (Myc-DDK tagged) - Human voltage-dependent anion channel 3 (VDAC3), transcript variant 2, 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK |
Tag | Myc-DDK |
Lenti ORF particles, VDAC3 (mGFP-tagged) - Human voltage-dependent anion channel 3 (VDAC3), transcript variant 2, 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP |
Tag | mGFP |
Lenti ORF clone of Human voltage-dependent anion channel 3 (VDAC3), transcript variant 2, Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, VDAC3 (Myc-DDK tagged) - Human voltage-dependent anion channel 3 (VDAC3), transcript variant 2, 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF clone of Human voltage-dependent anion channel 3 (VDAC3), transcript variant 2, mGFP tagged
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, VDAC3 (mGFP-tagged) - Human voltage-dependent anion channel 3 (VDAC3), transcript variant 2, 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
VDAC3 (Myc-DDK-tagged)-Human voltage-dependent anion channel 3 (VDAC3), transcript variant 1
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
Lenti-ORF clone of VDAC3 (Myc-DDK-tagged)-Human voltage-dependent anion channel 3 (VDAC3), transcript variant 1
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, VDAC3 (Myc-DDK-tagged)-Human voltage-dependent anion channel 3 (VDAC3), transcript variant 1, 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti-ORF clone of VDAC3 (mGFP-tagged)-Human voltage-dependent anion channel 3 (VDAC3), transcript variant 1
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, VDAC3 (mGFP-tagged)-Human voltage-dependent anion channel 3 (VDAC3), transcript variant 1, 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
VDAC3 (GFP-tagged) - Human voltage-dependent anion channel 3 (VDAC3), transcript variant 1
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
Lenti ORF clone of Human voltage-dependent anion channel 3 (VDAC3), transcript variant 2, Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK |
Tag | Myc-DDK |
Mammalian Cell Selection | None |
VDAC3 (untagged)-Human voltage-dependent anion channel 3 (VDAC3), transcript variant 2
Vector | pCMV6-XL5 |
Tag | Tag Free |
Mammalian Cell Selection | None |
VDAC3 (untagged)-Human voltage-dependent anion channel 3 (VDAC3), transcript variant 1
Vector | pCMV6-XL4 |
Tag | Tag Free |
Mammalian Cell Selection | None |
Purified recombinant protein of Human voltage-dependent anion channel 3 (VDAC3), transcript variant 2, full length, with N-terminal GST and C-terminal His tag, expressed in E. coli, 50ug
Tag | N-GST and C-His |
Expression Host | E. coli |
Lenti ORF clone of Human voltage-dependent anion channel 3 (VDAC3), transcript variant 2, mGFP tagged
Vector | pLenti-C-mGFP |
Tag | mGFP |
Mammalian Cell Selection | None |
Rabbit Polyclonal Anti-VDAC3 Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-VDAC3 antibody: synthetic peptide directed towards the N terminal of human VDAC3. Synthetic peptide located within the following region: KWNTDNTLGTEISWENKLAEGLKLTLDTIFVPNTGKKSGKLKASYKRDCF |
Transient overexpression lysate of voltage-dependent anion channel 3 (VDAC3), transcript variant 2
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
Rabbit Polyclonal Anti-VDAC3 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-VDAC3 antibody: synthetic peptide directed towards the N terminal of human VDAC3. Synthetic peptide located within the following region: SCSGVEFSTSGHAYTDTGKASGNLETKYKVCNYGLTFTQKWNTDNTLGTE |
VDAC3 HEK293T cell transient overexpression lysate (as WB positive control)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
Rabbit Polyclonal Anti-VDAC3 Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Full length fusion protein |
Transient overexpression of VDAC3 (NM_005662) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of VDAC3 (NM_001135694) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of VDAC3 (NM_005662) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of VDAC3 (NM_005662) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Transient overexpression of VDAC3 (NM_001135694) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack