Products

cDNA Clones (18)
Proteins (15)
Antibodies (2)
Jump to Filters
View as table Download
SCN3B (NM_018400) Human Tagged ORF Clone
RC224237

USD 420.00

In Stock

SCN3B (Myc-DDK-tagged)-Human sodium channel, voltage-gated, type III, beta (SCN3B), transcript variant 1

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
SCN3B (NM_001040151) Human Tagged ORF Clone
RC223114

USD 420.00

In Stock

SCN3B (Myc-DDK-tagged)-Human sodium channel, voltage-gated, type III, beta (SCN3B), transcript variant 2

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
SCN3B (NM_018400) Human Tagged ORF Clone Lentiviral Particle
RC224237L1V

USD 820.00

3 Weeks

Lenti ORF particles, SCN3B (Myc-DDK tagged) - Human sodium channel, voltage-gated, type III, beta (SCN3B), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
  • LentiORF®
SCN3B (NM_018400) Human Tagged ORF Clone
RG224237

USD 460.00

In Stock

SCN3B (GFP-tagged) - Human sodium channel, voltage-gated, type III, beta (SCN3B), transcript variant 1

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
SCN3B (NM_018400) Human Tagged ORF Clone Lentiviral Particle
RC224237L2V

USD 820.00

6 Weeks

Lenti ORF particles, SCN3B (mGFP-tagged) - Human sodium channel, voltage-gated, type III, beta (SCN3B), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP
Tag mGFP
  • LentiORF®
SCN3B (NM_001040151) Human Tagged ORF Clone
RC223114L3

USD 620.00

3 Weeks

Lenti ORF clone of Human sodium channel, voltage-gated, type III, beta (SCN3B), transcript variant 2, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
SCN3B (NM_001040151) Human Tagged ORF Clone Lentiviral Particle
RC223114L3V

USD 820.00

6 Weeks

Lenti ORF particles, SCN3B (Myc-DDK tagged) - Human sodium channel, voltage-gated, type III, beta (SCN3B), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
SCN3B (NM_001040151) Human Tagged ORF Clone
RC223114L4

USD 620.00

3 Weeks

Lenti ORF clone of Human sodium channel, voltage-gated, type III, beta (SCN3B), transcript variant 2, mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
SCN3B (NM_001040151) Human Tagged ORF Clone Lentiviral Particle
RC223114L4V

USD 820.00

6 Weeks

Lenti ORF particles, SCN3B (mGFP-tagged) - Human sodium channel, voltage-gated, type III, beta (SCN3B), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
SCN3B (NM_018400) Human Tagged ORF Clone
RC224237L3

USD 620.00

3 Weeks

Lenti ORF clone of Human sodium channel, voltage-gated, type III, beta (SCN3B), transcript variant 1, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
SCN3B (NM_018400) Human Tagged ORF Clone Lentiviral Particle
RC224237L3V

USD 820.00

7 Weeks

Lenti ORF particles, SCN3B (Myc-DDK tagged) - Human sodium channel, voltage-gated, type III, beta (SCN3B), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
SCN3B (NM_018400) Human Tagged ORF Clone Lentiviral Particle
RC224237L4V

USD 820.00

3 Weeks

Lenti ORF particles, SCN3B (mGFP-tagged) - Human sodium channel, voltage-gated, type III, beta (SCN3B), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
SCN3B (NM_001040151) Human Tagged ORF Clone
RG223114

USD 460.00

3 Weeks

SCN3B (GFP-tagged) - Human sodium channel, voltage-gated, type III, beta (SCN3B), transcript variant 2

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
SCN3B (NM_018400) Human Untagged Clone
SC312490

USD 420.00

In Stock

SCN3B (untagged)-Human sodium channel, voltage-gated, type III, beta (SCN3B), transcript variant 1

Vector pCMV6-XL6
Tag Tag Free
Mammalian Cell Selection None
SC312490 is the updated version of SC122106.
SCN3B (NM_018400) Human Tagged ORF Clone
RC224237L1

USD 768.00

In Stock

Lenti ORF clone of Human sodium channel, voltage-gated, type III, beta (SCN3B), transcript variant 1, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
Mammalian Cell Selection None
  • LentiORF®
SCN3B (NM_018400) Human Tagged ORF Clone
RC224237L2

USD 620.00

3 Weeks

Lenti ORF clone of Human sodium channel, voltage-gated, type III, beta (SCN3B), transcript variant 1, mGFP tagged

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®
SCN3B Rabbit Polyclonal Antibody
TA331466

USD 375.00

5 Days

Rabbit polyclonal Anti-SCN3B Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-SCN3B antibody: synthetic peptide directed towards the N terminal of human SCN3B. Synthetic peptide located within the following region: RPEGGKDFLIYEYRNGHQEVESPFQGRLQWNGSKDLQDVSITVLNVTLND
SCN3B Rabbit Polyclonal Antibody
TA590260

USD 409.00

In Stock

Rabbit Polyclonal SCN3B Antibody

Applications ELISA
Reactivities Human
Conjugation Unconjugated
Immunogen DNA immunization. This antibody is specific for the N Terminus Region of the target protein.
SCN3B (NM_018400) Human Over-expression Lysate
LC402676

USD 121.00

In Stock

SCN3B HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
SCN3B (NM_001040151) Human Over-expression Lysate
LC425685

USD 121.00

In Stock

SCN3B HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
SCN3B (NM_001040151) Human Untagged Clone
SC310915

USD 420.00

5 Days

SCN3B (untagged)-Human sodium channel, voltage-gated, type III, beta (SCN3B), transcript variant 2

Vector pCMV6-XL6
Tag Tag Free
Mammalian Cell Selection None
SCN3B (23-159, His-tag) Human Protein
AR51109PU-N

USD 1,105.00

2 Weeks

SCN3B (23-159, His-tag) human recombinant protein, 0.25 mg

Tag His-tag
Expression Host E. coli
SCN3B (23-159, His-tag) Human Protein
AR51109PU-S

USD 415.00

2 Weeks

SCN3B (23-159, His-tag) human recombinant protein, 50 µg

Tag His-tag
Expression Host E. coli
SCN3B (NM_001040151) Human Over-expression Lysate
LC421696

USD 121.00

2 Weeks

SCN3B HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
SCN3B (NM_001040151) Human Over-expression Lysate
LY421696

USD 396.00

5 Days

Transient overexpression lysate of sodium channel, voltage-gated, type III, beta (SCN3B), transcript variant 2

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB

Special Offer: Get a 20% discount on this product. Use code: "OEL20".

LY421696 is the same product as LY425685.
SCN3B (NM_001040151) Human Mass Spec Standard
PH323114

USD 2,055.00

3 Weeks

SCN3B MS Standard C13 and N15-labeled recombinant protein (NP_001035241)

Tag C-Myc/DDK
Expression Host HEK293
SCN3B (NM_018400) Human Tagged ORF Clone
RC224237L4

USD 620.00

In Stock

Lenti ORF clone of Human sodium channel, voltage-gated, type III, beta (SCN3B), transcript variant 1, mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
SCN3B (NM_001040151) ICC Control Block
TB423114

USD 1,070.00

4 Weeks

Transient overexpression of SCN3B (NM_001040151) in HEK293T cells paraffin embedded controls for ICC/IHC staining

SCN3B (NM_018400) ICC Control Block
TB424237

USD 1,070.00

4 Weeks

Transient overexpression of SCN3B (NM_018400) in HEK293T cells paraffin embedded controls for ICC/IHC staining

SCN3B Cytosection
TS423114

USD 225.00

4 Weeks

Transient overexpression of SCN3B (NM_001040151) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

SCN3B Cytosection
TS423114P5

USD 889.00

4 Weeks

Transient overexpression of SCN3B (NM_001040151) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack

SCN3B Cytosection
TS424237

USD 225.00

4 Weeks

Transient overexpression of SCN3B (NM_018400) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

SCN3B Cytosection
TS424237P5

USD 889.00

4 Weeks

Transient overexpression of SCN3B (NM_018400) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack