Products

View as table Download

SCN3B (Myc-DDK-tagged)-Human sodium channel, voltage-gated, type III, beta (SCN3B), transcript variant 1

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin

SCN3B (Myc-DDK-tagged)-Human sodium channel, voltage-gated, type III, beta (SCN3B), transcript variant 2

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin

Lenti ORF particles, SCN3B (Myc-DDK tagged) - Human sodium channel, voltage-gated, type III, beta (SCN3B), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
  • LentiORF®

SCN3B (GFP-tagged) - Human sodium channel, voltage-gated, type III, beta (SCN3B), transcript variant 1

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®

Lenti ORF particles, SCN3B (mGFP-tagged) - Human sodium channel, voltage-gated, type III, beta (SCN3B), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP
Tag mGFP
  • LentiORF®

Lenti ORF clone of Human sodium channel, voltage-gated, type III, beta (SCN3B), transcript variant 2, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, SCN3B (Myc-DDK tagged) - Human sodium channel, voltage-gated, type III, beta (SCN3B), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF clone of Human sodium channel, voltage-gated, type III, beta (SCN3B), transcript variant 2, mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, SCN3B (mGFP-tagged) - Human sodium channel, voltage-gated, type III, beta (SCN3B), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF clone of Human sodium channel, voltage-gated, type III, beta (SCN3B), transcript variant 1, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, SCN3B (Myc-DDK tagged) - Human sodium channel, voltage-gated, type III, beta (SCN3B), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, SCN3B (mGFP-tagged) - Human sodium channel, voltage-gated, type III, beta (SCN3B), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

SCN3B (GFP-tagged) - Human sodium channel, voltage-gated, type III, beta (SCN3B), transcript variant 2

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®

SCN3B (untagged)-Human sodium channel, voltage-gated, type III, beta (SCN3B), transcript variant 1

Vector pCMV6-XL6
Tag Tag Free
Mammalian Cell Selection None
SC312490 is the updated version of SC122106.

Lenti ORF clone of Human sodium channel, voltage-gated, type III, beta (SCN3B), transcript variant 1, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
Mammalian Cell Selection None
  • LentiORF®

Lenti ORF clone of Human sodium channel, voltage-gated, type III, beta (SCN3B), transcript variant 1, mGFP tagged

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®

Rabbit polyclonal Anti-SCN3B Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-SCN3B antibody: synthetic peptide directed towards the N terminal of human SCN3B. Synthetic peptide located within the following region: RPEGGKDFLIYEYRNGHQEVESPFQGRLQWNGSKDLQDVSITVLNVTLND

Rabbit Polyclonal SCN3B Antibody

Applications ELISA
Reactivities Human
Conjugation Unconjugated
Immunogen DNA immunization. This antibody is specific for the N Terminus Region of the target protein.

SCN3B HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB

SCN3B HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB

SCN3B (untagged)-Human sodium channel, voltage-gated, type III, beta (SCN3B), transcript variant 2

Vector pCMV6-XL6
Tag Tag Free
Mammalian Cell Selection None

SCN3B (23-159, His-tag) human recombinant protein, 0.25 mg

Tag His-tag
Expression Host E. coli

SCN3B (23-159, His-tag) human recombinant protein, 50 µg

Tag His-tag
Expression Host E. coli

SCN3B HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB

Transient overexpression lysate of sodium channel, voltage-gated, type III, beta (SCN3B), transcript variant 2

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB

Special Offer: Get a 20% discount on this product. Use code: "OEL20".

LY421696 is the same product as LY425685.

SCN3B MS Standard C13 and N15-labeled recombinant protein (NP_001035241)

Tag C-Myc/DDK
Expression Host HEK293

Lenti ORF clone of Human sodium channel, voltage-gated, type III, beta (SCN3B), transcript variant 1, mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

Transient overexpression of SCN3B (NM_001040151) in HEK293T cells paraffin embedded controls for ICC/IHC staining

Transient overexpression of SCN3B (NM_018400) in HEK293T cells paraffin embedded controls for ICC/IHC staining

USD 225.00

4 Weeks

Transient overexpression of SCN3B (NM_001040151) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

USD 889.00

4 Weeks

Transient overexpression of SCN3B (NM_001040151) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack

USD 225.00

4 Weeks

Transient overexpression of SCN3B (NM_018400) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

USD 889.00

4 Weeks

Transient overexpression of SCN3B (NM_018400) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack