Purified recombinant protein of Homo sapiens nuclear receptor subfamily 4, group A, member 1 (NR4A1), transcript variant 1
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
Special Offer: Get a 20% discount on this product. Use code: "MVPro20".
NR4A1 (Myc-DDK-tagged)-Human nuclear receptor subfamily 4, group A, member 1 (NR4A1), transcript variant 1
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
NR4A1 (GFP-tagged) - Human nuclear receptor subfamily 4, group A, member 1 (NR4A1), transcript variant 1
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
NR4A1 (untagged)-Human nuclear receptor subfamily 4, group A, member 1 (NR4A1), transcript variant 1
| Vector | pCMV6-XL5 |
| Tag | Tag Free |
| Mammalian Cell Selection | None |
Lenti ORF particles, NR4A1 (Myc-DDK tagged) - Human nuclear receptor subfamily 4, group A, member 1 (NR4A1), transcript variant 1, 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
Lenti ORF particles, NR4A1 (mGFP-tagged) - Human nuclear receptor subfamily 4, group A, member 1 (NR4A1), transcript variant 1, 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
NR4A1 (Myc-DDK-tagged)-Human nuclear receptor subfamily 4, group A, member 1 (NR4A1), transcript variant 2
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
NR4A1 (myc-DDK-tagged) - Human nuclear receptor subfamily 4, group A, member 1 (NR4A1), transcript variant 4
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
NR4A1 (GFP-tagged) - Human nuclear receptor subfamily 4, group A, member 1 (NR4A1), transcript variant 2
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
Lenti ORF particles, NR4A1 (Myc-DDK tagged) - Human nuclear receptor subfamily 4, group A, member 1 (NR4A1), transcript variant 1, 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
Lenti-ORF clone of NR4A1 (Myc-DDK-tagged)-Human nuclear receptor subfamily 4, group A, member 1 (NR4A1), transcript variant 2
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
Lenti ORF particles, NR4A1 (Myc-DDK-tagged)-Human nuclear receptor subfamily 4, group A, member 1 (NR4A1), transcript variant 2, 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
Lenti-ORF clone of NR4A1 (mGFP-tagged)-Human nuclear receptor subfamily 4, group A, member 1 (NR4A1), transcript variant 2
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
Lenti ORF particles, NR4A1 (mGFP-tagged)-Human nuclear receptor subfamily 4, group A, member 1 (NR4A1), transcript variant 2, 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
NR4A1 (Myc-DDK tagged) - Homo sapiens nuclear receptor subfamily 4, group A, member 1 (NR4A1), transcript variant 3
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
NR4A1 (GFP-tagged) - Homo sapiens nuclear receptor subfamily 4, group A, member 1 (NR4A1), transcript variant 3
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
Rabbit polyclonal Nuclear Receptor NR4A1 (Ab-351) antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human Nuclear Receptor NR4A1 around the phosphorylation site of serine 351 (L-P-SP-K-P). |
NR4A1 (untagged)-Human nuclear receptor subfamily 4, group A, member 1 (NR4A1), transcript variant 1
| Vector | pCMV6-AC |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
NR4A1 (untagged)-Human nuclear receptor subfamily 4, group A, member 1 (NR4A1), transcript variant 2
| Vector | pCMV6-XL5 |
| Tag | Tag Free |
| Mammalian Cell Selection | None |
NR4A1 (untagged) - Human nuclear receptor subfamily 4, group A, member 1 (NR4A1), transcript variant 4
| Vector | PCMV6-Neo |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
NR4A1 (untagged)-Human nuclear receptor subfamily 4, group A, member 1 (NR4A1), transcript variant 3
| Vector | pCMV6-XL5 |
| Tag | Tag Free |
| Mammalian Cell Selection | None |
Rabbit polyclonal Nuclear Receptor NR4A1 (Ser351)(Phospho-specific)
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human Nuclear Receptor NR4A1 around the phosphorylation site of serine 351 (L-P-SP-K-P). |
| Modifications | Phospho-specific |
Rabbit Polyclonal Anti-NR4A1 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-NR4A1 antibody: synthetic peptide directed towards the N terminal of human NR4A1. Synthetic peptide located within the following region: GTPAPSPGPRDHLASDPLTPEFIKPTMDLASPEAAPAAPTALPSFSTFMD |
Rabbit Polyclonal Anti-NR4A1 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-NR4A1 antibody: synthetic peptide directed towards the N terminal of human NR4A1. Synthetic peptide located within the following region: GTPAPSPGPRDHLASDPLTPEFIKPTMDLASPEAAPAAPTALPSFSTFMD |
Rabbit Polyclonal Anti-NR4A1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-NR4A1 antibody: synthetic peptide directed towards the C terminal of human NR4A1. Synthetic peptide located within the following region: RGRLPSKPKQPPDASPANLLTSLVRAHLDSGPSTAKLDYSKFQELVLPHF |
Rabbit Polyclonal Anti-NR4A1 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-NR4A1 antibody: synthetic peptide directed towards the middle region of human NR4A1. Synthetic peptide located within the following region: FQKCLAVGMVKEVVRTDSLKGRRGRLPSKPKQPPDASPANLLTSLVRAHL |
Goat Polyclonal Antibody against NR4A1
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-GRLPSKPKQPPDAS, from the internal region of the protein sequence according to NP_002126.2; NP_775180.1. |
Rabbit Polyclonal Anti-NR4A1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-NR4A1 antibody is: synthetic peptide directed towards the C-terminal region of Human NR4A1. Synthetic peptide located within the following region: DSILAFSRSLHSLLVDVPAFACLSALVLITDRHGLQEPRRVEELQNRIAS |
Rabbit Polyclonal Anti-NR4A1 Antibody (N-Terminus)
| Applications | IHC |
| Reactivities | Human |
| Immunogen | NR4A1 / NUR77 antibody was raised against synthetic 16 amino acid peptide from N-terminal to DNA binding domain of human NUR77. Percent identity with other species by BLAST analysis: Human (100%); Gorilla, Gibbon, Monkey (94%); Orangutan, Marmoset, Elephant (88%); Bovine, Panda, Horse (81%). |
Rabbit Polyclonal Anti-NR4A1 Antibody (N-Terminus)
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | NR4A1 / NUR77 antibody was raised against synthetic 15 amino acid peptide from N-terminal to DNA binding domain of human NUR77. Percent identity with other species by BLAST analysis: Human, Gorilla, Orangutan, Gibbon, Monkey, Mouse, Rat, Hamster (100%); Marmoset, Elephant, Panda, Bovine, Dog, Horse (93%); Bat, Rabbit (87%). |
NR4A1 MS Standard C13 and N15-labeled recombinant protein (NP_002126)
| Tag | C-Myc/DDK |
| Expression Host | HEK293 |
NR4A1 (GFP-tagged) - Human nuclear receptor subfamily 4, group A, member 1 (NR4A1), transcript variant 4
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
NR4A1 (untagged) - Homo sapiens nuclear receptor subfamily 4, group A, member 1 (NR4A1), transcript variant 3
| Vector | pCMV6 series |
| Tag | Tag Free |
Rabbit Polyclonal Anti-NR4A1 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human NR4A1 |
Transient overexpression of NR4A1 (NM_002135) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of NR4A1 (NM_173157) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of NR4A1 (NM_001202233) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of NR4A1 (NM_001202234) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of NR4A1 (NM_002135) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of NR4A1 (NM_002135) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Transient overexpression of NR4A1 (NM_173157) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of NR4A1 (NM_173157) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Transient overexpression of NR4A1 (NM_001202233) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Transient overexpression of NR4A1 (NM_001202234) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of NR4A1 (NM_001202234) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Germany
Japan
United Kingdom
China
