Products

View as table Download

CYP4F3 (Myc-DDK-tagged)-Human cytochrome P450, family 4, subfamily F, polypeptide 3 (CYP4F3), transcript variant 1

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®

CYP4F3 (GFP-tagged) - Human cytochrome P450, family 4, subfamily F, polypeptide 3 (CYP4F3), transcript variant 1

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®

Lenti-ORF clone of CYP4F3 (Myc-DDK-tagged)-Human cytochrome P450, family 4, subfamily F, polypeptide 3 (CYP4F3), transcript variant 1

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, CYP4F3 (Myc-DDK-tagged)-Human cytochrome P450, family 4, subfamily F, polypeptide 3 (CYP4F3), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti-ORF clone of CYP4F3 (mGFP-tagged)-Human cytochrome P450, family 4, subfamily F, polypeptide 3 (CYP4F3), transcript variant 1

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, CYP4F3 (mGFP-tagged)-Human cytochrome P450, family 4, subfamily F, polypeptide 3 (CYP4F3), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

CYP4F3 (Myc-DDK tagged) - Homo sapiens cytochrome P450, family 4, subfamily F, polypeptide 3 (CYP4F3), transcript variant 2

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®

CYP4F3 (Myc-DDK tagged) - Homo sapiens cytochrome P450, family 4, subfamily F, polypeptide 3 (CYP4F3), transcript variant 3

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®

CYP4F3 (GFP-tagged) - Homo sapiens cytochrome P450, family 4, subfamily F, polypeptide 3 (CYP4F3), transcript variant 2

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®

CYP4F3 (GFP-tagged) - Homo sapiens cytochrome P450, family 4, subfamily F, polypeptide 3 (CYP4F3), transcript variant 3

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®

Rabbit Polyclonal Anti-CYP4F3 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CYP4F3 antibody: synthetic peptide directed towards the N terminal of human CYP4F3. Synthetic peptide located within the following region: LAWTYTFYDNCCRLRCFPQPPKRNWFLGHLGLIHSSEEGLLYTQSLACTF

CYP4F3 (untagged)-Human cytochrome P450, family 4, subfamily F, polypeptide 3 (CYP4F3), transcript variant 1

Vector pCMV6-XL4
Tag Tag Free
Mammalian Cell Selection None

CYP4F3 (N-term) rabbit polyclonal antibody

Applications WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide selected from the N-terminal region of human CYP4F3

CYP4F3 (untagged) - Homo sapiens cytochrome P450, family 4, subfamily F, polypeptide 3 (CYP4F3), transcript variant 2

Vector pCMV6 series
Tag Tag Free

CYP4F3 (untagged) - Homo sapiens cytochrome P450, family 4, subfamily F, polypeptide 3 (CYP4F3), transcript variant 3

Vector pCMV6 series
Tag Tag Free

Transient overexpression of CYP4F3 (NM_000896) in HEK293T cells paraffin embedded controls for ICC/IHC staining

Transient overexpression of CYP4F3 (NM_001199208) in HEK293T cells paraffin embedded controls for ICC/IHC staining

Transient overexpression of CYP4F3 (NM_001199209) in HEK293T cells paraffin embedded controls for ICC/IHC staining

USD 225.00

4 Weeks

Transient overexpression of CYP4F3 (NM_000896) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

USD 889.00

4 Weeks

Transient overexpression of CYP4F3 (NM_000896) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack

Transient overexpression of CYP4F3 (NM_001199208) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack

Transient overexpression of CYP4F3 (NM_001199209) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack