Rabbit polyclonal His6-DEP-1 Antibody
Applications | IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Poly-HIS protein were used to produced this antibody. |
Rabbit polyclonal His6-DEP-1 Antibody
Applications | IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Poly-HIS protein were used to produced this antibody. |
Rabbit anti-PTPN6 Polyclonal Antibody
Applications | ICC/IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human PTPN6 |
Rabbit Polyclonal Anti-ACP1 Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-ACP1 antibody: synthetic peptide directed towards the N terminal of human ACP1. Synthetic peptide located within the following region: PIAEAVFRKLVTDQNISENWRVDSAATSGYEIGNPPDYRGQSCMKRHGIP |
Rabbit Polyclonal PTPN1 Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | DNA immunization. In vivo generated recombinant protein fragment |
SHP1 (PTPN6) mouse monoclonal antibody, clone PTY11, Purified
Applications | ELISA, IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
SHP1 (PTPN6) mouse monoclonal antibody, clone PTY15, Purified
Applications | ELISA, IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Goat Polyclonal Antibody against PTPN6
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence C-HTKNKREEKVKKQ, from the internal region (near the C Terminus) of the protein sequence according to NP_536858.1; NP_002822.2. |
Mouse Anti-Human PTPN6 / SHP-1 Monoclonal Antibody
Applications | IHC |
Reactivities | Human |
Conjugation | Unconjugated |
Rabbit polyclonal SHP-1 (Phospho-Tyr564) antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human SHP-1 around the phosphorylation site of tyrosine 564 (D-V-YP-E-N). |
Modifications | Phospho-specific |
Rabbit Polyclonal Phospho-SHP-1 (Tyr536) Antibody (Phospho-specific)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against A synthesized peptide derived from human SHP-1 around the phosphorylation site of Tyrosine 536 |
Modifications | Phospho-specific |
Rabbit Polyclonal PTP1B Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against A synthesized peptide derived from human PTP1B |
Rabbit Polyclonal Anti-ACP1 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-ACP1 antibody: synthetic peptide directed towards the middle region of human ACP1. Synthetic peptide located within the following region: NISENWVIDSGAVSDWNVGRSPDPRAVSCLRNHGIHTAHKARQITKEDFA |
Rabbit Polyclonal Phospho-PTP1B (Ser50) Antibody (Phospho-specific)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against A synthesized peptide derived from human PTP1B around the phosphorylation site of Serine 50 |
Modifications | Phospho-specific |
Rabbit Polyclonal SHP-1 Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against A synthesized peptide derived from human SHP-1 |
Mouse Monoclonal SHP-1 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Goat Polyclonal Antibody against PTPN6 (Internal Region)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence C-KASRTSSKHKEE, from the internal region of the protein sequence according to NP_536858.1; NP_002822.2. |
PTPRM Rabbit Polyclonal (Internal) Antibody
Applications | IHC |
Reactivities | Gibbon, Hamster, Horse, Human, Mouse, Rabbit, Rat |
Conjugation | Unconjugated |
Immunogen | PTPRM / PTP Mu antibody was raised against synthetic 18 amino acid peptide from internal region of human PTPRM. Percent identity with other species by BLAST analysis: Human, Gibbon, Monkey, Mouse, Rat, Hamster, Panda, Horse, Rabbit, Opossum (100%); Marmoset, Bovine, Bat (94%). |
Rabbit Polyclonal Anti-PTPRM Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-PTPRM antibody is: synthetic peptide directed towards the middle region of Human PTPRM. Synthetic peptide located within the following region: QQFQFLGWPMYRDTPVSKRSFLKLIRQVDKWQEEYNGGEGRTVVHCLNGG |
Carrier-free (BSA/glycerol-free) PTPN1 mouse monoclonal antibody, clone OTI1B4 (formerly 1B4)
Applications | FC, WB |
Reactivities | Human, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) PTPN1 mouse monoclonal antibody, clone OTI1A2 (formerly 1A2)
Applications | FC, IF, WB |
Reactivities | Human, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) PTPN1 mouse monoclonal antibody, clone OTI2G3 (formerly 2G3)
Applications | FC, IF, IHC, WB |
Reactivities | Human, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) PTPN1 mouse monoclonal antibody, clone OTI1C5 (formerly 1C5)
Applications | IHC, WB |
Reactivities | Human, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) PTPN1 mouse monoclonal antibody, clone OTI1D10 (formerly 1D10)
Applications | FC, IF, IHC, WB |
Reactivities | Human, Monkey, Rat, Dog |
Conjugation | Unconjugated |
Anti-PTPN6 Rabbit Polyclonal Antibody
Applications | ELISA, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein corresponding to a region derived from 244-515 amino acids of human protein tyrosine phosphatase, non-receptor type 6 |
Anti-PTPRJ Rabbit Polyclonal Antibody
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide corresponding to a region derived from 1323-1337 amino acids of Human protein tyrosine phosphatase, receptor type, J |
Anti-PTPRJ Rabbit Polyclonal Antibody
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide corresponding to a region derived from 1323-1337 amino acids of Human protein tyrosine phosphatase, receptor type, J |
Anti-PTPRM Rabbit Polyclonal Antibody
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide corresponding to a region derived from 1370-1385 amino acids of Human protein tyrosine phosphatase, receptor type, M |
Anti-PTPRM Rabbit Polyclonal Antibody
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide corresponding to a region derived from 1370-1385 amino acids of Human protein tyrosine phosphatase, receptor type, M |
PTPN1 (PTP1B) mouse monoclonal antibody, clone OTI1B4 (formerly 1B4)
Applications | FC, WB |
Reactivities | Human, Rat |
Conjugation | Unconjugated |
USD 420.00
4 Weeks
PTPN1 (PTP1B) mouse monoclonal antibody, clone OTI1B4 (formerly 1B4), Biotinylated
Applications | FC, WB |
Reactivities | Human, Rat |
Conjugation | Biotin |
USD 420.00
4 Weeks
PTPN1 (PTP1B) mouse monoclonal antibody, clone OTI1B4 (formerly 1B4), HRP conjugated
Applications | FC, WB |
Reactivities | Human, Rat |
Conjugation | HRP |
PTPN1 (PTP1B) mouse monoclonal antibody, clone OTI1B4 (formerly 1B4)
Applications | FC, WB |
Reactivities | Human, Rat |
Conjugation | Unconjugated |
PTPN1 (PTP1B) mouse monoclonal antibody, clone OTI1A2 (formerly 1A2)
Applications | FC, IF, WB |
Reactivities | Human, Rat |
Conjugation | Unconjugated |
USD 420.00
4 Weeks
PTPN1 (PTP1B) mouse monoclonal antibody, clone OTI1A2 (formerly 1A2), Biotinylated
Applications | FC, IF, WB |
Reactivities | Human, Rat |
Conjugation | Biotin |
USD 420.00
4 Weeks
PTPN1 (PTP1B) mouse monoclonal antibody, clone OTI1A2 (formerly 1A2), HRP conjugated
Applications | FC, IF, WB |
Reactivities | Human, Rat |
Conjugation | HRP |
PTPN1 (PTP1B) mouse monoclonal antibody, clone OTI1A2 (formerly 1A2)
Applications | FC, IF, WB |
Reactivities | Human, Rat |
Conjugation | Unconjugated |
PTPN1 (PTP1B) mouse monoclonal antibody, clone OTI2G3 (formerly 2G3)
Applications | FC, IF, IHC, WB |
Reactivities | Human, Rat |
Conjugation | Unconjugated |
USD 420.00
4 Weeks
PTPN1 (PTP1B) mouse monoclonal antibody, clone OTI2G3 (formerly 2G3), Biotinylated
Applications | FC, IF, IHC, WB |
Reactivities | Human, Rat |
Conjugation | Biotin |
USD 420.00
4 Weeks
PTPN1 (PTP1B) mouse monoclonal antibody, clone OTI2G3 (formerly 2G3), HRP conjugated
Applications | FC, IF, IHC, WB |
Reactivities | Human, Rat |
Conjugation | HRP |
PTPN1 (PTP1B) mouse monoclonal antibody, clone OTI2G3 (formerly 2G3)
Applications | FC, IF, IHC, WB |
Reactivities | Human, Rat |
Conjugation | Unconjugated |
PTPN1 (PTP1B) mouse monoclonal antibody, clone OTI1C5 (formerly 1C5)
Applications | IHC, WB |
Reactivities | Human, Rat |
Conjugation | Unconjugated |
USD 420.00
4 Weeks
PTPN1 (PTP1B) mouse monoclonal antibody, clone OTI1C5 (formerly 1C5), Biotinylated
Applications | IHC, WB |
Reactivities | Human, Rat |
Conjugation | Biotin |
USD 420.00
4 Weeks
PTPN1 (PTP1B) mouse monoclonal antibody, clone OTI1C5 (formerly 1C5), HRP conjugated
Applications | IHC, WB |
Reactivities | Human, Rat |
Conjugation | HRP |
PTPN1 (PTP1B) mouse monoclonal antibody, clone OTI1C5 (formerly 1C5)
Applications | IHC, WB |
Reactivities | Human, Rat |
Conjugation | Unconjugated |
PTPN1 (PTP1B) mouse monoclonal antibody, clone OTI1D10 (formerly 1D10)
Applications | FC, IF, IHC, WB |
Reactivities | Human, Monkey, Rat, Dog |
Conjugation | Unconjugated |
USD 420.00
4 Weeks
PTPN1 (PTP1B) mouse monoclonal antibody, clone OTI1D10 (formerly 1D10), Biotinylated
Applications | FC, IF, IHC, WB |
Reactivities | Human, Monkey, Rat, Dog |
Conjugation | Biotin |
USD 420.00
4 Weeks
PTPN1 (PTP1B) mouse monoclonal antibody, clone OTI1D10 (formerly 1D10), HRP conjugated
Applications | FC, IF, IHC, WB |
Reactivities | Human, Monkey, Rat, Dog |
Conjugation | HRP |
PTPN1 (PTP1B) mouse monoclonal antibody, clone OTI1D10 (formerly 1D10)
Applications | FC, IF, IHC, WB |
Reactivities | Human, Monkey, Rat, Dog |
Conjugation | Unconjugated |