Products

View as table Download

Lenti ORF particles, MTMR1 (mGFP-tagged) - Human myotubularin related protein 1 (MTMR1), 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

MTMR1 (Myc-DDK-tagged)-Human myotubularin related protein 1 (MTMR1)

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin

MTMR6 (Myc-DDK-tagged)-Human myotubularin related protein 6 (MTMR6)

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin

MTMR2 (Myc-DDK-tagged)-Human myotubularin related protein 2 (MTMR2), transcript variant 1

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin

MTMR7 (Myc-DDK-tagged)-Human myotubularin related protein 7 (MTMR7)

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin

MTMR2 (Myc-DDK-tagged)-Human myotubularin related protein 2 (MTMR2), transcript variant 3

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin

Lenti ORF particles, MTMR6 (Myc-DDK tagged) - Human myotubularin related protein 6 (MTMR6), 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
  • LentiORF®

Lenti ORF particles, MTMR6 (mGFP-tagged) - Human myotubularin related protein 6 (MTMR6), 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP
Tag mGFP
  • LentiORF®

Lenti ORF particles, MTMR2 (Myc-DDK tagged) - Human myotubularin related protein 2 (MTMR2), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
  • LentiORF®

Lenti ORF particles, MTMR2 (mGFP-tagged) - Human myotubularin related protein 2 (MTMR2), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP
Tag mGFP
  • LentiORF®

Lenti ORF particles, MTMR1 (Myc-DDK tagged) - Human myotubularin related protein 1 (MTMR1), 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
  • LentiORF®

Lenti ORF particles, MTMR1 (mGFP-tagged) - Human myotubularin related protein 1 (MTMR1), 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP
Tag mGFP
  • LentiORF®

Lenti ORF particles, MTMR7 (Myc-DDK tagged) - Human myotubularin related protein 7 (MTMR7), 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
  • LentiORF®

Lenti ORF particles, MTMR7 (mGFP-tagged) - Human myotubularin related protein 7 (MTMR7), 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP
Tag mGFP
  • LentiORF®

MTMR2 (GFP-tagged) - Human myotubularin related protein 2 (MTMR2), transcript variant 1

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®

MTMR2 (GFP-tagged) - Human myotubularin related protein 2 (MTMR2), transcript variant 3

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®

MTMR7 (GFP-tagged) - Human myotubularin related protein 7 (MTMR7)

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®

Lenti ORF clone of Human myotubularin related protein 6 (MTMR6), Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, MTMR6 (Myc-DDK tagged) - Human myotubularin related protein 6 (MTMR6), 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF clone of Human myotubularin related protein 6 (MTMR6), mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, MTMR6 (mGFP-tagged) - Human myotubularin related protein 6 (MTMR6), 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF clone of Human myotubularin related protein 2 (MTMR2), transcript variant 1, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, MTMR2 (Myc-DDK tagged) - Human myotubularin related protein 2 (MTMR2), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF clone of Human myotubularin related protein 2 (MTMR2), transcript variant 1, mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, MTMR2 (mGFP-tagged) - Human myotubularin related protein 2 (MTMR2), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF clone of Human myotubularin related protein 1 (MTMR1), Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, MTMR1 (Myc-DDK tagged) - Human myotubularin related protein 1 (MTMR1), 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF clone of Human myotubularin related protein 1 (MTMR1), mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF clone of Human myotubularin related protein 2 (MTMR2), transcript variant 3, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, MTMR2 (Myc-DDK tagged) - Human myotubularin related protein 2 (MTMR2), transcript variant 3, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF clone of Human myotubularin related protein 2 (MTMR2), transcript variant 3, mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, MTMR2 (mGFP-tagged) - Human myotubularin related protein 2 (MTMR2), transcript variant 3, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF clone of Human myotubularin related protein 7 (MTMR7), Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, MTMR7 (Myc-DDK tagged) - Human myotubularin related protein 7 (MTMR7), 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF clone of Human myotubularin related protein 7 (MTMR7), mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, MTMR7 (mGFP-tagged) - Human myotubularin related protein 7 (MTMR7), 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

MTMR2 (Myc-DDK tagged) - Homo sapiens myotubularin related protein 2 (MTMR2), transcript variant 4

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®

MTMR6 (GFP-tagged) - Human myotubularin related protein 6 (MTMR6)

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®

MTMR1 (GFP-tagged) - Human myotubularin related protein 1 (MTMR1)

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®

MTMR2 (GFP-tagged) - Homo sapiens myotubularin related protein 2 (MTMR2), transcript variant 4

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®

Lenti ORF clone of Human myotubularin related protein 6 (MTMR6), Myc-DDK-tagged

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
Mammalian Cell Selection None
  • LentiORF®

Lenti ORF clone of Human myotubularin related protein 1 (MTMR1), Myc-DDK-tagged

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
Mammalian Cell Selection None
  • LentiORF®

Lenti ORF clone of Human myotubularin related protein 7 (MTMR7), Myc-DDK-tagged

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
Mammalian Cell Selection None
  • LentiORF®

Lenti ORF clone of Human myotubularin related protein 2 (MTMR2), transcript variant 1, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
Mammalian Cell Selection None
  • LentiORF®

MTMR2 (untagged)-Human myotubularin related protein 2 (MTMR2), transcript variant 3

Vector pCMV6-XL4
Tag Tag Free
Mammalian Cell Selection None

Rabbit Polyclonal Anti-MTMR1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-MTMR1 antibody: synthetic peptide directed towards the C terminal of human MTMR1. Synthetic peptide located within the following region: KEDVYTKTISLWSYINSQLDEFSNPFFVNYENHVLYPVASLSHLELWVNY

Lenti ORF clone of Human myotubularin related protein 6 (MTMR6), mGFP tagged

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®

Lenti ORF clone of Human myotubularin related protein 2 (MTMR2), transcript variant 1, mGFP tagged

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®