PPP2R1B (Myc-DDK-tagged)-Human protein phosphatase 2, regulatory subunit A, beta (PPP2R1B), transcript variant 2
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
PPP2R1B (Myc-DDK-tagged)-Human protein phosphatase 2, regulatory subunit A, beta (PPP2R1B), transcript variant 2
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
PPP2R1B (Myc-DDK-tagged)-Human protein phosphatase 2, regulatory subunit A, beta (PPP2R1B), transcript variant 4
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
PPP2R1B (Myc-DDK-tagged)-Human protein phosphatase 2, regulatory subunit A, beta (PPP2R1B), transcript variant 3
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
Lenti ORF particles, PPP2R1B (Myc-DDK tagged) - Human protein phosphatase 2, regulatory subunit A, beta (PPP2R1B), transcript variant 2, 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK |
Tag | Myc-DDK |
Lenti ORF particles, PPP2R1B (mGFP-tagged) - Human protein phosphatase 2, regulatory subunit A, beta (PPP2R1B), transcript variant 2, 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP |
Tag | mGFP |
PPP2R1B (GFP-tagged) - Human protein phosphatase 2, regulatory subunit A, beta (PPP2R1B), transcript variant 2
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
PPP2R1B (Myc-DDK-tagged)-Human protein phosphatase 2, regulatory subunit A, beta (PPP2R1B), transcript variant 5
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
Lenti ORF clone of Human protein phosphatase 2, regulatory subunit A, beta (PPP2R1B), transcript variant 2, Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, PPP2R1B (Myc-DDK tagged) - Human protein phosphatase 2, regulatory subunit A, beta (PPP2R1B), transcript variant 2, 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, PPP2R1B (mGFP-tagged) - Human protein phosphatase 2, regulatory subunit A, beta (PPP2R1B), transcript variant 2, 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
PPP2R1B (Myc-DDK-tagged)-Human protein phosphatase 2, regulatory subunit A, beta (PPP2R1B), transcript variant 1
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
Lenti-ORF clone of PPP2R1B (Myc-DDK-tagged)-Human protein phosphatase 2, regulatory subunit A, beta (PPP2R1B), transcript variant 1
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, PPP2R1B (Myc-DDK-tagged)-Human protein phosphatase 2, regulatory subunit A, beta (PPP2R1B), transcript variant 1, 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti-ORF clone of PPP2R1B (mGFP-tagged)-Human protein phosphatase 2, regulatory subunit A, beta (PPP2R1B), transcript variant 1
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, PPP2R1B (mGFP-tagged)-Human protein phosphatase 2, regulatory subunit A, beta (PPP2R1B), transcript variant 1, 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti-ORF clone of PPP2R1B (Myc-DDK-tagged)-Human protein phosphatase 2, regulatory subunit A, beta (PPP2R1B), transcript variant 5
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, PPP2R1B (Myc-DDK-tagged)-Human protein phosphatase 2, regulatory subunit A, beta (PPP2R1B), transcript variant 5, 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti-ORF clone of PPP2R1B (mGFP-tagged)-Human protein phosphatase 2, regulatory subunit A, beta (PPP2R1B), transcript variant 5
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, PPP2R1B (mGFP-tagged)-Human protein phosphatase 2, regulatory subunit A, beta (PPP2R1B), transcript variant 5, 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti-ORF clone of PPP2R1B (Myc-DDK-tagged)-Human protein phosphatase 2, regulatory subunit A, beta (PPP2R1B), transcript variant 4
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, PPP2R1B (Myc-DDK-tagged)-Human protein phosphatase 2, regulatory subunit A, beta (PPP2R1B), transcript variant 4, 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti-ORF clone of PPP2R1B (mGFP-tagged)-Human protein phosphatase 2, regulatory subunit A, beta (PPP2R1B), transcript variant 4
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, PPP2R1B (mGFP-tagged)-Human protein phosphatase 2, regulatory subunit A, beta (PPP2R1B), transcript variant 4, 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti-ORF clone of PPP2R1B (Myc-DDK-tagged)-Human protein phosphatase 2, regulatory subunit A, beta (PPP2R1B), transcript variant 3
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, PPP2R1B (Myc-DDK-tagged)-Human protein phosphatase 2, regulatory subunit A, beta (PPP2R1B), transcript variant 3, 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti-ORF clone of PPP2R1B (mGFP-tagged)-Human protein phosphatase 2, regulatory subunit A, beta (PPP2R1B), transcript variant 3
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, PPP2R1B (mGFP-tagged)-Human protein phosphatase 2, regulatory subunit A, beta (PPP2R1B), transcript variant 3, 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
PPP2R1B (GFP-tagged) - Human protein phosphatase 2, regulatory subunit A, beta (PPP2R1B), transcript variant 1
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
PPP2R1B (GFP-tagged) - Human protein phosphatase 2, regulatory subunit A, beta (PPP2R1B), transcript variant 5
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
PPP2R1B (GFP-tagged) - Human protein phosphatase 2, regulatory subunit A, beta (PPP2R1B), transcript variant 4
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
PPP2R1B (GFP-tagged) - Human protein phosphatase 2, regulatory subunit A, beta (PPP2R1B), transcript variant 3
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
PPP2R1B (untagged)-Human protein phosphatase 2, regulatory subunit A, beta (PPP2R1B), transcript variant 2
Vector | pCMV6-XL5 |
Tag | Tag Free |
Mammalian Cell Selection | None |
Rabbit Polyclonal Anti-PPP2R1B Antibody - N-terminal region
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-PPP2R1B antibody: synthetic peptide directed towards the N terminal of human PPP2R1B. Synthetic peptide located within the following region: EDVQLRLNSIKKLSTIALALGVERTRSELLPFLTDTIYDEDEVLLALAEQ |
Lenti ORF clone of Human protein phosphatase 2, regulatory subunit A, beta (PPP2R1B), transcript variant 2, Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK |
Tag | Myc-DDK |
Mammalian Cell Selection | None |
Lenti ORF clone of Human protein phosphatase 2, regulatory subunit A, beta (PPP2R1B), transcript variant 2, mGFP tagged
Vector | pLenti-C-mGFP |
Tag | mGFP |
Mammalian Cell Selection | None |
PPP2R1B rabbit polyclonal antibody, Purified
Applications | IHC, WB |
Reactivities | Bovine, Human, Mouse, Rat |
Immunogen | A peptide conjugated to KLH |
PPP2R1B sheep polyclonal antibody, Purified
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Immunogen | The immunogen used to the purified peptide conjugated to KLH corresponding to the sequence NH2-Phe-Ser-Gln-Val-Lys-Gly-Ala-Val-Asp-Asp-Asp-Val-Ala-Glu-COOH. This peptide antibody corresponds to N -terminal peptide of PP2A/B a regulatory subunit having a MW of 55kD. |
PPP2R1B HEK293T cell transient overexpression lysate (as WB positive control)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
PPP2R1B HEK293T cell transient overexpression lysate (as WB positive control)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
Transient overexpression lysate of protein phosphatase 2, regulatory subunit A, beta (PPP2R1B), transcript variant 4
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
Transient overexpression lysate of protein phosphatase 2, regulatory subunit A, beta (PPP2R1B), transcript variant 3
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
PPP2R1B (untagged)-Human protein phosphatase 2, regulatory subunit A, beta (PPP2R1B), transcript variant 1
Vector | pCMV6-XL4 |
Tag | Tag Free |
Mammalian Cell Selection | None |
Rabbit polyclonal anti-PPP2R1B antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human PPP2R1B. |
Carrier-free (BSA/glycerol-free) PPP2R1B mouse monoclonal antibody,clone OTI9F3
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) PPP2R1B mouse monoclonal antibody,clone OTI8B6
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) PPP2R1B mouse monoclonal antibody,clone OTI8C5
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
PPP2R1B HEK293T cell transient overexpression lysate (as WB positive control)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
Transient overexpression lysate of protein phosphatase 2 (formerly 2A), regulatory subunit A, beta isoform (PPP2R1B), transcript variant 2
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
Lenti ORF clone of Human protein phosphatase 2, regulatory subunit A, beta (PPP2R1B), transcript variant 2, mGFP tagged
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
PPP2R1B (untagged)-Human protein phosphatase 2 regulatory subunit A beta (PPP2R1B) transcript variant 5
Vector | pCMV6-Entry |
Tag | Tag Free |
Mammalian Cell Selection | Neomycin |