PPP2R5C (Myc-DDK-tagged)-Human protein phosphatase 2, regulatory subunit B', gamma (PPP2R5C), transcript variant 1
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
PPP2R5C (Myc-DDK-tagged)-Human protein phosphatase 2, regulatory subunit B', gamma (PPP2R5C), transcript variant 1
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
PPP2R5C (Myc-DDK-tagged)-Human protein phosphatase 2, regulatory subunit B', gamma isoform (PPP2R5C), transcript variant 4
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
PPP2R5C (Myc-DDK-tagged)-Human protein phosphatase 2, regulatory subunit B', gamma (PPP2R5C), transcript variant 6
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
PPP2R5C (Myc-DDK-tagged)-Human protein phosphatase 2, regulatory subunit B', gamma (PPP2R5C), transcript variant 5
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
Lenti ORF particles, PPP2R5C (Myc-DDK tagged) - Human protein phosphatase 2, regulatory subunit B', gamma (PPP2R5C), transcript variant 1, 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK |
Tag | Myc-DDK |
Lenti ORF particles, PPP2R5C (mGFP-tagged) - Human protein phosphatase 2, regulatory subunit B', gamma (PPP2R5C), transcript variant 1, 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP |
Tag | mGFP |
PPP2R5C (GFP-tagged) - Human protein phosphatase 2, regulatory subunit B', gamma (PPP2R5C), transcript variant 1
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
PPP2R5C (GFP-tagged) - Human protein phosphatase 2, regulatory subunit B', gamma (PPP2R5C), transcript variant 3
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
Lenti ORF clone of Human protein phosphatase 2, regulatory subunit B', gamma isoform (PPP2R5C), transcript variant 4, Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, PPP2R5C (Myc-DDK tagged) - Human protein phosphatase 2, regulatory subunit B', gamma isoform (PPP2R5C), transcript variant 4, 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF clone of Human protein phosphatase 2, regulatory subunit B', gamma isoform (PPP2R5C), transcript variant 4, mGFP tagged
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, PPP2R5C (mGFP-tagged) - Human protein phosphatase 2, regulatory subunit B', gamma isoform (PPP2R5C), transcript variant 4, 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
PPP2R5C (Myc-DDK-tagged)-Human protein phosphatase 2, regulatory subunit B', gamma (PPP2R5C), transcript variant 2
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
Lenti-ORF clone of PPP2R5C (Myc-DDK-tagged)-Human protein phosphatase 2, regulatory subunit B', gamma (PPP2R5C), transcript variant 2
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, PPP2R5C (Myc-DDK-tagged)-Human protein phosphatase 2, regulatory subunit B', gamma (PPP2R5C), transcript variant 2, 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti-ORF clone of PPP2R5C (mGFP-tagged)-Human protein phosphatase 2, regulatory subunit B', gamma (PPP2R5C), transcript variant 2
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, PPP2R5C (mGFP-tagged)-Human protein phosphatase 2, regulatory subunit B', gamma (PPP2R5C), transcript variant 2, 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti ORF clone of Human protein phosphatase 2, regulatory subunit B', gamma (PPP2R5C), transcript variant 1, Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, PPP2R5C (Myc-DDK tagged) - Human protein phosphatase 2, regulatory subunit B', gamma (PPP2R5C), transcript variant 1, 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF clone of Human protein phosphatase 2, regulatory subunit B', gamma (PPP2R5C), transcript variant 1, mGFP tagged
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, PPP2R5C (mGFP-tagged) - Human protein phosphatase 2, regulatory subunit B', gamma (PPP2R5C), transcript variant 1, 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
PPP2R5C (Myc-DDK-tagged)-Human protein phosphatase 2, regulatory subunit B', gamma (PPP2R5C), transcript variant 3
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
Lenti-ORF clone of PPP2R5C (Myc-DDK-tagged)-Human protein phosphatase 2, regulatory subunit B', gamma (PPP2R5C), transcript variant 3
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, PPP2R5C (Myc-DDK-tagged)-Human protein phosphatase 2, regulatory subunit B', gamma (PPP2R5C), transcript variant 3, 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti-ORF clone of PPP2R5C (mGFP-tagged)-Human protein phosphatase 2, regulatory subunit B', gamma (PPP2R5C), transcript variant 3
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, PPP2R5C (mGFP-tagged)-Human protein phosphatase 2, regulatory subunit B', gamma (PPP2R5C), transcript variant 3, 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti-ORF clone of PPP2R5C (Myc-DDK-tagged)-Human protein phosphatase 2, regulatory subunit B', gamma (PPP2R5C), transcript variant 6
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, PPP2R5C (Myc-DDK-tagged)-Human protein phosphatase 2, regulatory subunit B', gamma (PPP2R5C), transcript variant 6, 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti-ORF clone of PPP2R5C (mGFP-tagged)-Human protein phosphatase 2, regulatory subunit B', gamma (PPP2R5C), transcript variant 6
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, PPP2R5C (mGFP-tagged)-Human protein phosphatase 2, regulatory subunit B', gamma (PPP2R5C), transcript variant 6, 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti-ORF clone of PPP2R5C (Myc-DDK-tagged)-Human protein phosphatase 2, regulatory subunit B', gamma (PPP2R5C), transcript variant 5
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, PPP2R5C (Myc-DDK-tagged)-Human protein phosphatase 2, regulatory subunit B', gamma (PPP2R5C), transcript variant 5, 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti-ORF clone of PPP2R5C (mGFP-tagged)-Human protein phosphatase 2, regulatory subunit B', gamma (PPP2R5C), transcript variant 5
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, PPP2R5C (mGFP-tagged)-Human protein phosphatase 2, regulatory subunit B', gamma (PPP2R5C), transcript variant 5, 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
PPP2R5C (GFP-tagged) - Human protein phosphatase 2, regulatory subunit B', gamma isoform (PPP2R5C), transcript variant 4
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
PPP2R5C (GFP-tagged) - Human protein phosphatase 2, regulatory subunit B', gamma (PPP2R5C), transcript variant 2
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
PPP2R5C (GFP-tagged) - Human protein phosphatase 2, regulatory subunit B', gamma (PPP2R5C), transcript variant 6
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
PPP2R5C (GFP-tagged) - Human protein phosphatase 2, regulatory subunit B', gamma (PPP2R5C), transcript variant 5
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
Lenti ORF clone of Human protein phosphatase 2, regulatory subunit B', gamma (PPP2R5C), transcript variant 1, Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK |
Tag | Myc-DDK |
Mammalian Cell Selection | None |
PPP2R5C (untagged)-Human protein phosphatase 2, regulatory subunit B', gamma (PPP2R5C), transcript variant 2
Vector | pCMV6-XL4 |
Tag | Tag Free |
Mammalian Cell Selection | None |
Rabbit Polyclonal Anti-PPP2R5C Antibody - middle region
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-PPP2R5C antibody: synthetic peptide directed towards the middle region of human PPP2R5C. Synthetic peptide located within the following region: RFLESPDFQPNIAKKYIDQKFVLQLLELFDSEDPRERDFLKTTLHRIYGK |
Transient overexpression lysate of protein phosphatase 2, regulatory subunit B', gamma isoform (PPP2R5C), transcript variant 4
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
Lenti ORF clone of Human protein phosphatase 2, regulatory subunit B', gamma (PPP2R5C), transcript variant 1, mGFP tagged
Vector | pLenti-C-mGFP |
Tag | mGFP |
Mammalian Cell Selection | None |
PPP2R5C HEK293T cell transient overexpression lysate (as WB positive control)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
PPP2R5C HEK293T cell transient overexpression lysate (as WB positive control)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
Transient overexpression lysate of protein phosphatase 2, regulatory subunit B', gamma (PPP2R5C), transcript variant 6
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
Transient overexpression lysate of protein phosphatase 2, regulatory subunit B', gamma (PPP2R5C), transcript variant 5
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
PPP2R5C (untagged)-Human protein phosphatase 2, regulatory subunit B', gamma (PPP2R5C), transcript variant 1
Vector | pCMV6-XL4 |
Tag | Tag Free |
Mammalian Cell Selection | None |
PPP2R5C (untagged)-Human protein phosphatase 2, regulatory subunit B', gamma isoform (PPP2R5C), transcript variant 4
Vector | pCMV6-XL5 |
Tag | Tag Free |
Mammalian Cell Selection | None |
PPP2R5C rabbit polyclonal antibody, Purified
Applications | WB |
Reactivities | Bovine, Human, Mouse, Rat |
Immunogen | Antibody raised against synthetic peptide corresponding to amino acids 53 to 66 of the mammalian protein phosphatase 2 A/B conjugated to KLH. |