Products

cDNA Clones (42)
Proteins (27)
Antibodies (6)
Jump to Filters
View as table Download
BACE1 (NM_012104) Human Tagged ORF Clone
RC209115

USD 480.00

In Stock

BACE1 (Myc-DDK-tagged)-Human beta-site APP-cleaving enzyme 1 (BACE1), transcript variant a

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
BACE1 (NM_012104) Human Untagged Clone
SC115547

USD 310.00

In Stock

BACE1 (untagged)-Human beta-site APP-cleaving enzyme 1 (BACE1), transcript variant a

Vector pCMV6-XL5
Tag Tag Free
Mammalian Cell Selection None
BACE1 (NM_138973) Human Tagged ORF Clone
RC219054

USD 420.00

In Stock

BACE1 (Myc-DDK-tagged)-Human beta-site APP-cleaving enzyme 1 (BACE1), transcript variant d

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
BACE1 (NM_012104) Human Tagged ORF Clone Lentiviral Particle
RC209115L4V

USD 1,092.00

3 Weeks

Lenti ORF particles, BACE1 (mGFP-tagged) - Human beta-site APP-cleaving enzyme 1 (BACE1), transcript variant a, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
BACE1 (NM_138971) Human Tagged ORF Clone
RC220224

USD 430.00

In Stock

BACE1 (Myc-DDK-tagged)-Human beta-site APP-cleaving enzyme 1 (BACE1), transcript variant c

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
BACE1 (NM_012104) Human Tagged ORF Clone
RG209115

USD 530.00

In Stock

BACE1 (GFP-tagged) - Human beta-site APP-cleaving enzyme 1 (BACE1), transcript variant a

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
BACE1 (NM_012104) Human Tagged ORF Clone Lentiviral Particle
RC209115L1V

USD 880.00

3 Weeks

Lenti ORF particles, BACE1 (Myc-DDK tagged) - Human beta-site APP-cleaving enzyme 1 (BACE1), transcript variant a, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
  • LentiORF®
BACE1 (NM_012104) Human Tagged ORF Clone Lentiviral Particle
RC209115L2V

USD 880.00

6 Weeks

Lenti ORF particles, BACE1 (mGFP-tagged) - Human beta-site APP-cleaving enzyme 1 (BACE1), transcript variant a, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP
Tag mGFP
  • LentiORF®
BACE1 (NM_138973) Human Tagged ORF Clone Lentiviral Particle
RC219054L1V

USD 820.00

3 Weeks

Lenti ORF particles, BACE1 (Myc-DDK tagged) - Human beta-site APP-cleaving enzyme 1 (BACE1), transcript variant d, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
  • LentiORF®
BACE1 (NM_138973) Human Tagged ORF Clone Lentiviral Particle
RC219054L2V

USD 820.00

6 Weeks

Lenti ORF particles, BACE1 (mGFP-tagged) - Human beta-site APP-cleaving enzyme 1 (BACE1), transcript variant d, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP
Tag mGFP
  • LentiORF®
BACE1 (NM_138972) Human Tagged ORF Clone
RG220265

USD 500.00

In Stock

BACE1 (GFP-tagged) - Human beta-site APP-cleaving enzyme 1 (BACE1), transcript variant b

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
BACE1 (NM_012104) Human Tagged ORF Clone Lentiviral Particle
RC209115L3V

USD 880.00

3 Weeks

Lenti ORF particles, BACE1 (Myc-DDK tagged) - Human beta-site APP-cleaving enzyme 1 (BACE1), transcript variant a, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
BACE1 (NM_012104) Human Tagged ORF Clone
RC209115L4

USD 680.00

In Stock

Lenti ORF clone of Human beta-site APP-cleaving enzyme 1 (BACE1), transcript variant a, mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
BACE1 (NM_138973) Human Tagged ORF Clone
RC219054L3

USD 620.00

3 Weeks

Lenti ORF clone of Human beta-site APP-cleaving enzyme 1 (BACE1), transcript variant d, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
BACE1 (NM_138973) Human Tagged ORF Clone Lentiviral Particle
RC219054L3V

USD 820.00

7 Weeks

Lenti ORF particles, BACE1 (Myc-DDK tagged) - Human beta-site APP-cleaving enzyme 1 (BACE1), transcript variant d, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
BACE1 (NM_138973) Human Tagged ORF Clone
RC219054L4

USD 620.00

3 Weeks

Lenti ORF clone of Human beta-site APP-cleaving enzyme 1 (BACE1), transcript variant d, mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
BACE1 (NM_138973) Human Tagged ORF Clone Lentiviral Particle
RC219054L4V

USD 820.00

7 Weeks

Lenti ORF particles, BACE1 (mGFP-tagged) - Human beta-site APP-cleaving enzyme 1 (BACE1), transcript variant d, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
BACE1 (NM_138971) Human Tagged ORF Clone
RC220224L3

USD 630.00

3 Weeks

Lenti ORF clone of Human beta-site APP-cleaving enzyme 1 (BACE1), transcript variant c, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
BACE1 (NM_138971) Human Tagged ORF Clone Lentiviral Particle
RC220224L3V

USD 830.00

6 Weeks

Lenti ORF particles, BACE1 (Myc-DDK tagged) - Human beta-site APP-cleaving enzyme 1 (BACE1), transcript variant c, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
BACE1 (NM_138971) Human Tagged ORF Clone
RC220224L4

USD 630.00

3 Weeks

Lenti ORF clone of Human beta-site APP-cleaving enzyme 1 (BACE1), transcript variant c, mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
BACE1 (NM_138971) Human Tagged ORF Clone Lentiviral Particle
RC220224L4V

USD 830.00

6 Weeks

Lenti ORF particles, BACE1 (mGFP-tagged) - Human beta-site APP-cleaving enzyme 1 (BACE1), transcript variant c, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
BACE1 (NM_138972) Human Tagged ORF Clone
RC220265

USD 450.00

3 Weeks

BACE1 (Myc-DDK-tagged)-Human beta-site APP-cleaving enzyme 1 (BACE1), transcript variant b

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
BACE1 (NM_138972) Human Tagged ORF Clone
RC220265L3

USD 650.00

3 Weeks

Lenti-ORF clone of BACE1 (Myc-DDK-tagged)-Human beta-site APP-cleaving enzyme 1 (BACE1), transcript variant b

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
BACE1 (NM_138972) Human Tagged ORF Clone Lentiviral Particle
RC220265L3V

USD 850.00

6 Weeks

Lenti ORF particles, BACE1 (Myc-DDK-tagged)-Human beta-site APP-cleaving enzyme 1 (BACE1), transcript variant b, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
BACE1 (NM_138972) Human Tagged ORF Clone
RC220265L4

USD 650.00

3 Weeks

Lenti-ORF clone of BACE1 (mGFP-tagged)-Human beta-site APP-cleaving enzyme 1 (BACE1), transcript variant b

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
BACE1 (NM_138972) Human Tagged ORF Clone Lentiviral Particle
RC220265L4V

USD 850.00

6 Weeks

Lenti ORF particles, BACE1 (mGFP-tagged)-Human beta-site APP-cleaving enzyme 1 (BACE1), transcript variant b, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
BACE1 (NM_001207049) Human Tagged ORF Clone
RC232613

USD 420.00

3 Weeks

BACE1 (Myc-DDK tagged) - Homo sapiens beta-site APP-cleaving enzyme 1 (BACE1), transcript variant f

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
BACE1 (NM_001207048) Human Tagged ORF Clone
RC232660

USD 420.00

3 Weeks

BACE1 (Myc-DDK tagged) - Homo sapiens beta-site APP-cleaving enzyme 1 (BACE1), transcript variant e

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
BACE1 (NM_138973) Human Tagged ORF Clone
RG219054

USD 460.00

3 Weeks

BACE1 (GFP-tagged) - Human beta-site APP-cleaving enzyme 1 (BACE1), transcript variant d

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
BACE1 (NM_138971) Human Tagged ORF Clone
RG220224

USD 470.00

3 Weeks

BACE1 (GFP-tagged) - Human beta-site APP-cleaving enzyme 1 (BACE1), transcript variant c

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
BACE1 (NM_001207049) Human Tagged ORF Clone
RG232613

USD 460.00

3 Weeks

BACE1 (GFP-tagged) - Homo sapiens beta-site APP-cleaving enzyme 1 (BACE1), transcript variant f

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
BACE1 (NM_001207048) Human Tagged ORF Clone
RG232660

USD 460.00

3 Weeks

BACE1 (GFP-tagged) - Homo sapiens beta-site APP-cleaving enzyme 1 (BACE1), transcript variant e

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
BACE1 (NM_012104) Human Tagged ORF Clone
RC209115L1

USD 840.00

In Stock

Lenti ORF clone of Human beta-site APP-cleaving enzyme 1 (BACE1), transcript variant a, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
Mammalian Cell Selection None
  • LentiORF®
BACE1 (NM_138973) Human Tagged Lenti ORF Clone
RC219054L1

USD 768.00

In Stock

Lenti ORF clone of Human beta-site APP-cleaving enzyme 1 (BACE1), transcript variant d, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
Mammalian Cell Selection None
  • LentiORF®
BACE1 (NM_012104) Human Over-expression Lysate
LY402147

USD 396.00

In Stock

Transient overexpression lysate of beta-site APP-cleaving enzyme 1 (BACE1), transcript variant a

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
BACE1 (NM_012104) Human Over-expression Lysate
LC402147

USD 121.00

In Stock

BACE1 HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
BACE1 Rabbit Polyclonal Antibody
TA306033

USD 430.00

In Stock

Rabbit Polyclonal BACE Antibody

Applications IF, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen BACE antibody was raised against a peptide corresponding to 17 amino acids at the carboxy terminus of human BACE.
BACE1 (NM_138971) Human Over-expression Lysate
LY430074

USD 396.00

In Stock

Transient overexpression lysate of beta-site APP-cleaving enzyme 1 (BACE1), transcript variant c

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
BACE1 (NM_012104) Human Tagged ORF Clone
RC209115L2

USD 680.00

3 Weeks

Lenti ORF clone of Human beta-site APP-cleaving enzyme 1 (BACE1), transcript variant a, mGFP tagged

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®
BACE1 (NM_138973) Human Tagged ORF Clone
RC219054L2

USD 620.00

3 Weeks

Lenti ORF clone of Human beta-site APP-cleaving enzyme 1 (BACE1), transcript variant d, mGFP tagged

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®
BACE1 Rabbit Polyclonal Antibody
TA341892

USD 375.00

5 Days

Rabbit Polyclonal Anti-BACE1 Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-BACE1 antibody: synthetic peptide directed towards the N terminal of human BACE1. Synthetic peptide located within the following region: GQGYYVEMTVGSPPQTLNILVDTGSSNFAVGAAPHPFLHRYYQRQLSSTY
BACE1 (NM_138973) Human Over-expression Lysate
LY430076

USD 396.00

5 Days

Transient overexpression lysate of beta-site APP-cleaving enzyme 1 (BACE1), transcript variant d

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
BACE1 (NM_138972) Human Untagged Clone
SC120577

USD 810.00

In Stock

BACE1 (untagged)-Human beta-site APP-cleaving enzyme 1 (BACE1), transcript variant b

Vector pCMV6-XL4
Tag Tag Free
Mammalian Cell Selection None
BACE1 Rabbit Polyclonal Antibody
TA341059

USD 425.00

5 Days

Rabbit Polyclonal Anti-BACE1 Antibody (Internal)

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen BACE1 / BACE antibody was raised against synthetic 15 amino acid peptide from internal region of human BACE1. Percent identity with other species by BLAST analysis: Human, Gibbon, Monkey, Marmoset, Mouse, Rat, Dog, Bat, Bovine, Hamster, Elephant, Panda, Horse, Rabbit, Pig, Opossum, Guinea pig (100%); Platypus (87%); Xenopus, Pufferfish, Zebrafish, Stickleback (80%).
BACE1 Rabbit Polyclonal Antibody
TA341171

USD 425.00

5 Days

Rabbit Polyclonal Anti-BACE1 Antibody (C-Terminus)

Applications IHC
Reactivities Human
Immunogen BACE1 / BACE antibody was raised against synthetic 18 amino acid peptide from C-terminus of human BACE1. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon, Monkey, Marmoset (100%); Mouse, Rat, Dog, Bat, Bovine, Hamster, Elephant, Panda, Horse, Rabbit, Pig, Guinea pig (94%); Opossum (89%); Turkey, Chicken, Platypus (83%).
BACE1 Rabbit Polyclonal Antibody
TA341891

USD 375.00

5 Days

Rabbit Polyclonal Anti-Bace1 Antibody

Applications WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-Bace1 antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: YTPIRREWYYEVIIVRVEINGQDLKMDCKEYNYDKSIVDSGTTNLRLPKK
BACE1 (NM_138971) Human Over-expression Lysate
LC408446

USD 187.00

2 Weeks

BACE1 HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
BACE1 (NM_138973) Human Over-expression Lysate
LC408448

USD 187.00

2 Weeks

BACE1 HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB