CAPN1 (Myc-DDK-tagged)-Human calpain 1, (mu/I) large subunit (CAPN1), transcript variant 2
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
CAPN1 (Myc-DDK-tagged)-Human calpain 1, (mu/I) large subunit (CAPN1), transcript variant 2
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
CAPN1 (untagged)-Human calpain 1, (mu/I) large subunit (CAPN1), transcript variant 2
Vector | pCMV6-XL5 |
Tag | Tag Free |
Mammalian Cell Selection | None |
USD 820.00
3 Weeks
Lenti ORF particles, CAPN1 (Myc-DDK tagged) - Human calpain 1, (mu/I) large subunit (CAPN1), transcript variant 2, 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK |
Tag | Myc-DDK |
USD 820.00
6 Weeks
Lenti ORF particles, CAPN1 (mGFP-tagged) - Human calpain 1, (mu/I) large subunit (CAPN1), transcript variant 2, 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP |
Tag | mGFP |
Lenti ORF clone of Human calpain 1, (mu/I) large subunit (CAPN1), transcript variant 2, Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
USD 820.00
5 Weeks
Lenti ORF particles, CAPN1 (Myc-DDK tagged) - Human calpain 1, (mu/I) large subunit (CAPN1), transcript variant 2, 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
USD 820.00
3 Weeks
Lenti ORF particles, CAPN1 (mGFP-tagged) - Human calpain 1, (mu/I) large subunit (CAPN1), transcript variant 2, 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
CAPN1 (Myc-DDK tagged) - Homo sapiens calpain 1, (mu/I) large subunit (CAPN1), transcript variant 1
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
CAPN1 (Myc-DDK tagged) - Homo sapiens calpain 1, (mu/I) large subunit (CAPN1), transcript variant 3
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
CAPN1 (GFP-tagged) - Human calpain 1, (mu/I) large subunit (CAPN1), transcript variant 2
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
CAPN1 (GFP-tagged) - Homo sapiens calpain 1, (mu/I) large subunit (CAPN1), transcript variant 1
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
CAPN1 (GFP-tagged) - Homo sapiens calpain 1, (mu/I) large subunit (CAPN1), transcript variant 3
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
Lenti ORF clone of Human calpain 1, (mu/I) large subunit (CAPN1), transcript variant 2, Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK |
Tag | Myc-DDK |
Mammalian Cell Selection | None |
Rabbit anti-CAPN1 Polyclonal Antibody
Applications | ICC/IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human CAPN1 |
CAPN1 HEK293T cell transient overexpression lysate (as WB positive control)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Lenti ORF clone of Human calpain 1, (mu/I) large subunit (CAPN1), transcript variant 2, mGFP tagged
Vector | pLenti-C-mGFP |
Tag | mGFP |
Mammalian Cell Selection | None |
Rabbit Polyclonal Anti-CAPN1 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-CAPN1 antibody: synthetic peptide directed towards the middle region of human CAPN1. Synthetic peptide located within the following region: EVEWTGAWSDSSSEWNNVDPYERDQLRVKMEDGEFWMSFRDFMREFTRLE |
Transient overexpression lysate of calpain 1, (mu/I) large subunit (CAPN1)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
Purified recombinant protein of Human calpain 1, (mu/I) large subunit (CAPN1), transcript variant 2, full length, with N-terminal GST and C-terminal His tag, expressed in E. coli, 50ug
Tag | N-GST and C-His |
Expression Host | E. coli |
Rabbit polyclonal anti-Calpain 1 antibody
Applications | WB |
Reactivities | Bovine, Human, Mouse, Rabbit, Rat, Pig |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide surrounding amino acid 700 of rat Calpain 1 |
Rabbit Polyclonal Anti-CAPN1 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-CAPN1 antibody: synthetic peptide directed towards the N terminal of human CAPN1. Synthetic peptide located within the following region: EFWSALLEKAYAKVNGSYEALSGGSTSEGFEDFTGGVTEWYELRKAPSDL |
CAPN1 (untagged) - Homo sapiens calpain 1, (mu/I) large subunit (CAPN1), transcript variant 1
Vector | pCMV6 series |
Tag | Tag Free |
CAPN1 (untagged) - Homo sapiens calpain 1, (mu/I) large subunit (CAPN1), transcript variant 3
Vector | pCMV6 series |
Tag | Tag Free |
Anti-CAPN1 Rabbit Polyclonal Antibody
Applications | ELISA, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein corresponding to a region derived from 543-713 amino acids of Human Calpain-1 catalytic subunit |
Anti-CAPN1 Rabbit Polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein corresponding to a region derived from 543-713 amino acids of Human Calpain-1 catalytic subunit |
Transient overexpression of CAPN1 (NM_005186) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of CAPN1 (NM_001198868) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of CAPN1 (NM_001198869) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of CAPN1 (NM_005186) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of CAPN1 (NM_005186) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Transient overexpression of CAPN1 (NM_001198868) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Transient overexpression of CAPN1 (NM_001198869) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack