Products

cDNA Clones (13)
Proteins (9)
Antibodies (4)
Jump to Filters
View as table Download
ADAM2 (NM_001464) Human Tagged ORF Clone
RC221139

USD 810.00

In Stock

ADAM2 (Myc-DDK-tagged)-Human ADAM metallopeptidase domain 2 (ADAM2)

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
ADAM2 (NM_001464) Human Tagged ORF Clone
RC221139L3

USD 1,010.00

3 Weeks

Lenti-ORF clone of ADAM2 (Myc-DDK-tagged)-Human ADAM metallopeptidase domain 2 (ADAM2)

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
ADAM2 (NM_001464) Human Tagged ORF Clone Lentiviral Particle
RC221139L3V

USD 1,210.00

6 Weeks

Lenti ORF particles, ADAM2 (Myc-DDK-tagged)-Human ADAM metallopeptidase domain 2 (ADAM2), 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
ADAM2 (NM_001464) Human Tagged ORF Clone
RC221139L4

USD 1,010.00

3 Weeks

Lenti-ORF clone of ADAM2 (mGFP-tagged)-Human ADAM metallopeptidase domain 2 (ADAM2)

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
ADAM2 (NM_001464) Human Tagged ORF Clone Lentiviral Particle
RC221139L4V

USD 1,210.00

6 Weeks

Lenti ORF particles, ADAM2 (mGFP-tagged)-Human ADAM metallopeptidase domain 2 (ADAM2), 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
ADAM2 (NM_001278114) Human Tagged ORF Clone
RC239281

USD 610.00

3 Weeks

ADAM2 (myc-DDK-tagged) - Human ADAM metallopeptidase domain 2 (ADAM2), transcript variant 3

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
ADAM2 (NM_001278113) Human Tagged ORF Clone
RC239394

USD 750.00

3 Weeks

ADAM2 (myc-DDK-tagged) - Human ADAM metallopeptidase domain 2 (ADAM2), transcript variant 2

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
ADAM2 (NM_001464) Human Tagged ORF Clone
RG221139

USD 890.00

3 Weeks

ADAM2 (GFP-tagged) - Human ADAM metallopeptidase domain 2 (ADAM2)

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
ADAM2 Rabbit Polyclonal Antibody
TA324288

USD 345.00

In Stock

Anti-ADAM2 Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein corresponding to C terminal 250 amino acids of human ADAM metallopeptidase domain 2
ADAM2 (NM_001464) Human Over-expression Lysate
LC419910

USD 187.00

In Stock

ADAM2 HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
ADAM2 (NM_001464) Human Untagged Clone
SC122596

USD 1,480.00

In Stock

ADAM2 (untagged)-Human ADAM metallopeptidase domain 2 (ADAM2)

Vector pCMV6-XL5
Tag Tag Free
Mammalian Cell Selection None
ADAM2 (NM_001464) Human Over-expression Lysate
LY419910

USD 605.00

In Stock

Transient overexpression lysate of ADAM metallopeptidase domain 2 (ADAM2)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
ADAM2 Rabbit Polyclonal Antibody
TA335864

USD 375.00

5 Days

Rabbit Polyclonal Anti-ADAM2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-ADAM2 Antibody: synthetic peptide directed towards the middle region of human ADAM2. Synthetic peptide located within the following region: PHDVAFLLVYREKSNYVGATFQGKMCDANYAGGVVLHPRTISLESLAVIL
ADAM2 (NM_001278114) Human Tagged ORF Clone
RG239281

USD 650.00

2 Weeks

ADAM2 (GFP-tagged) - Human ADAM metallopeptidase domain 2 (ADAM2), transcript variant 3

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
ADAM2 (NM_001278113) Human Tagged ORF Clone
RG239394

USD 790.00

2 Weeks

ADAM2 (GFP-tagged) - Human ADAM metallopeptidase domain 2 (ADAM2), transcript variant 2

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
ADAM2 (NM_001278114) Human Untagged Clone
SC337175

USD 690.00

3 Weeks

ADAM2 (untagged) - Human ADAM metallopeptidase domain 2 (ADAM2), transcript variant 3

Vector pCMV6-Entry
Tag Tag Free
Mammalian Cell Selection Neomycin
ADAM2 (NM_001278113) Human Untagged Clone
SC337288

USD 730.00

3 Weeks

ADAM2 (untagged) - Human ADAM metallopeptidase domain 2 (ADAM2), transcript variant 2

Vector pCMV6-Entry
Tag Tag Free
Mammalian Cell Selection Neomycin
ADAM2 Rabbit Polyclonal Antibody
TA324289

USD 345.00

In Stock

Anti-ADAM2 Rabbit Polyclonal Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein corresponding to C terminal 250 amino acids of human ADAM metallopeptidase domain 2
ADAM2 Rabbit Polyclonal Antibody
TA357130

USD 360.00

5 Days

ADAM2 Antibody - N-terminal region

Applications WB
Reactivities Human
Conjugation Unconjugated
ADAM2 ICC Control Block
TB421139

USD 1,460.00

4 Weeks

Transient overexpression of ADAM2 (NM_001464) in HEK293T cells paraffin embedded controls for ICC/IHC staining

ADAM2 ICC Control Block
TB439281

USD 1,260.00

4 Weeks

Transient overexpression of ADAM2 (NM_001278114) in HEK293T cells paraffin embedded controls for ICC/IHC staining

ADAM2 ICC Control Block
TB439394

USD 1,400.00

4 Weeks

Transient overexpression of ADAM2 (NM_001278113) in HEK293T cells paraffin embedded controls for ICC/IHC staining

ADAM2 Cytosection
TS421139

USD 225.00

4 Weeks

Transient overexpression of ADAM2 (NM_001464) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

ADAM2 Cytosection
TS421139P5

USD 889.00

4 Weeks

Transient overexpression of ADAM2 (NM_001464) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack

ADAM2 ICC Control Sections
TS439281P5

USD 889.00

4 Weeks

Transient overexpression of ADAM2 (NM_001278114) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack

ADAM2 ICC Control Sections
TS439394P5

USD 889.00

4 Weeks

Transient overexpression of ADAM2 (NM_001278113) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack