Germany
Japan
United Kingdom
China
ADAM2 (Myc-DDK-tagged)-Human ADAM metallopeptidase domain 2 (ADAM2)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
Products
View as table Download
Adam2 (Myc-DDK-tagged) - Mouse a disintegrin and metallopeptidase domain 2 (Adam2)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
ADAM2 - KN2.0, Human gene knockout kit via CRISPR, non-homology mediated.
| Format | 2 gRNA vectors, 1 linear donor |
| Donor DNA | EF1a-GFP-P2A-Puro |
KN421139 is the updated version of KN221139.
Adam2 - KN2.0, Mouse gene knockout kit via CRISPR, non-homology mediated.
| Format | 2 gRNA vectors, 1 linear donor |
| Donor DNA | EF1a-GFP-P2A-Puro |
KN500823 is the updated version of KN300823.
Adam2 (GFP-tagged) - Mouse a disintegrin and metallopeptidase domain 2 (Adam2), (10ug)
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti ORF clone of Adam2 (Myc-DDK-tagged) - Mouse a disintegrin and metallopeptidase domain 2 (Adam2)
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Adam2 (Myc-DDK-tagged) - Mouse a disintegrin and metallopeptidase domain 2 (Adam2), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Adam2 (mGFP-tagged) - Mouse a disintegrin and metallopeptidase domain 2 (Adam2)
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Adam2 (GFP-tagged) - Mouse a disintegrin and metallopeptidase domain 2 (Adam2), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti-ORF clone of ADAM2 (Myc-DDK-tagged)-Human ADAM metallopeptidase domain 2 (ADAM2)
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, ADAM2 (Myc-DDK-tagged)-Human ADAM metallopeptidase domain 2 (ADAM2), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti-ORF clone of ADAM2 (mGFP-tagged)-Human ADAM metallopeptidase domain 2 (ADAM2)
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, ADAM2 (mGFP-tagged)-Human ADAM metallopeptidase domain 2 (ADAM2), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
ADAM2 (myc-DDK-tagged) - Human ADAM metallopeptidase domain 2 (ADAM2), transcript variant 3
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
ADAM2 (myc-DDK-tagged) - Human ADAM metallopeptidase domain 2 (ADAM2), transcript variant 2
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
ADAM2 (GFP-tagged) - Human ADAM metallopeptidase domain 2 (ADAM2)
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Adam2 (Myc-DDK-tagged ORF) - Rat ADAM metallopeptidase domain 2 (Adam2), (10 ug)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti ORF clone of Adam2 (Myc-DDK-tagged ORF) - Rat ADAM metallopeptidase domain 2 (Adam2), (10 ug)
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Adam2 (Myc-DDK-tagged ORF) - Rat ADAM metallopeptidase domain 2 (Adam2), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Adam2 (mGFP-tagged ORF) - Rat ADAM metallopeptidase domain 2 (Adam2), (10 ug)
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Adam2 (GFP-tagged ORF) - Rat ADAM metallopeptidase domain 2 (Adam2), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
ADAM2 HEK293T cell transient overexpression lysate (as WB positive control)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
ADAM2 (untagged)-Human ADAM metallopeptidase domain 2 (ADAM2)
| Vector | pCMV6-XL5 |
| Tag | Tag Free |
| Mammalian Cell Selection | None |
Transient overexpression lysate of ADAM metallopeptidase domain 2 (ADAM2)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Rabbit Polyclonal Anti-ADAM2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-ADAM2 Antibody: synthetic peptide directed towards the middle region of human ADAM2. Synthetic peptide located within the following region: PHDVAFLLVYREKSNYVGATFQGKMCDANYAGGVVLHPRTISLESLAVIL |
ADAM2 CRISPRa kit - CRISPR gene activation of human ADAM metallopeptidase domain 2
| Format | 3gRNAs, 1 scramble ctrl and 1 enhancer vector |
Adam2 CRISPRa kit - CRISPR gene activation of mouse a disintegrin and metallopeptidase domain 2
| Format | 3gRNAs, 1 scramble ctrl and 1 enhancer vector |
qSTAR qPCR primer pairs against Homo sapiens gene ADAM2
| Component | 1 vial of lyophilized qSTAR qPCR primer mix (1 nmol each primer, sufficient for 200 reactions) |
Adam2 (untagged) - Mouse a disintegrin and metallopeptidase domain 2 (Adam2), (10ug)
| Vector | pCMV6-Entry |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
qSTAR qPCR primer pairs against Mus musculus gene Adam2
ADAM2 (GFP-tagged) - Human ADAM metallopeptidase domain 2 (ADAM2), transcript variant 3
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
ADAM2 (GFP-tagged) - Human ADAM metallopeptidase domain 2 (ADAM2), transcript variant 2
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Adam2 (untagged ORF) - Rat ADAM metallopeptidase domain 2 (Adam2), (10 ug)
| Vector | pCMV6-Entry |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
ADAM2 (untagged) - Human ADAM metallopeptidase domain 2 (ADAM2), transcript variant 3
| Vector | pCMV6-Entry |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
ADAM2 (untagged) - Human ADAM metallopeptidase domain 2 (ADAM2), transcript variant 2
| Vector | pCMV6-Entry |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
ADAM2 (Human) - 3 unique 27mer siRNA duplexes - 2 nmol each
| Purity | HPLC purified |
| Number of Transfections | Approximately 330 transfections/2nmol in 24-well plate under optimized conditions (final conc. 10 nM). |
Special offer: Get $100/€100 off this product. Use code: SR100
SR320209 is the updated version of SR301665.
Adam2 (Mouse) - 3 unique 27mer siRNA duplexes - 2 nmol each
| Purity | HPLC purified |
| Number of Transfections | Approximately 330 transfections/2nmol in 24-well plate under optimized conditions (final conc. 10 nM). |
Special offer: Get $100/€100 off this product. Use code: SR100
Adam2 (Rat) - 3 unique 27mer siRNA duplexes - 2 nmol each
| Purity | HPLC purified |
| Number of Transfections | Approximately 330 transfections/2nmol in 24-well plate under optimized conditions (final conc. 10 nM). |
Special offer: Get $100/€100 off this product. Use code: SR100
ADAM2 Antibody - N-terminal region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
ADAM2 Antibody - middle region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human ADAM2 |
ADAM2 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human ADAM2 |
| Modifications | Unmodified |
Transient overexpression of ADAM2 (NM_001464) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of ADAM2 (NM_001278114) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of ADAM2 (NM_001278113) in HEK293T cells paraffin embedded controls for ICC/IHC staining
ADAM2 - Human, 4 unique 29mer shRNA constructs in lentiviral GFP vector
| Format | Lentiviral plasmids |
| Vector | pGFP-C-shLenti |
| E. coli Selection | Chloramphenicol |
| Mammalian Cell Selection | Puromycin |
ADAM2 - Human shRNA lentiviral particles (4 unique 29mer target-specific shRNA, 1 scramble control), 0.5 ml each, >10^7 TU/ml.
| Format | Lentiviral particles |
| Vector | pGFP-C-shLenti |
Adam2 - Mouse, 4 unique 29mer shRNA constructs in lentiviral GFP vector
| Format | Lentiviral plasmids |
| Vector | pGFP-C-shLenti |
Adam2 - Mouse shRNA lentiviral particles (4 unique 29mer target-specific shRNA, 1 scramble control), 0.5 ml each, >10^7 TU/ml.
| Format | Lentiviral particles |
| Vector | pGFP-C-shLenti |
Active filters
Target Symbol
- ADAM2