FOLH1 (Myc-DDK-tagged)-Human folate hydrolase (prostate-specific membrane antigen) 1 (FOLH1), transcript variant 1
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
FOLH1 (Myc-DDK-tagged)-Human folate hydrolase (prostate-specific membrane antigen) 1 (FOLH1), transcript variant 1
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
USD 1,248.00
3 Weeks
Lenti ORF particles, FOLH1 (Myc-DDK tagged) - Human folate hydrolase (prostate-specific membrane antigen) 1 (FOLH1), transcript variant 1, 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Recombinant protein of human folate hydrolase (prostate-specific membrane antigen) 1 (FOLH1), transcript variant 1
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Special Offer: Get a 20% discount on this product. Use code: "MVPro20".
FOLH1 (Myc-DDK-tagged)-Human folate hydrolase (prostate-specific membrane antigen) 1 (FOLH1), transcript variant 2
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
USD 1,020.00
2 Weeks
Lenti ORF particles, FOLH1 (mGFP-tagged) - Human folate hydrolase (prostate-specific membrane antigen) 1 (FOLH1), transcript variant 5, 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
FOLH1 (Myc-DDK-tagged)-Human folate hydrolase (prostate-specific membrane antigen) 1 (FOLH1), transcript variant 5
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
USD 1,010.00
3 Weeks
Lenti ORF particles, FOLH1 (Myc-DDK tagged) - Human folate hydrolase (prostate-specific membrane antigen) 1 (FOLH1), transcript variant 2, 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK |
Tag | Myc-DDK |
USD 1,010.00
In Stock
Lenti ORF particles, FOLH1 (Myc-DDK tagged) - Human folate hydrolase (prostate-specific membrane antigen) 1 (FOLH1), transcript variant 1, 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK |
Tag | Myc-DDK |
FOLH1 (GFP-tagged) - Human folate hydrolase (prostate-specific membrane antigen) 1 (FOLH1), transcript variant 2
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
USD 1,010.00
6 Weeks
Lenti ORF particles, FOLH1 (mGFP-tagged) - Human folate hydrolase (prostate-specific membrane antigen) 1 (FOLH1), transcript variant 2, 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP |
Tag | mGFP |
USD 1,010.00
3 Weeks
Lenti ORF particles, FOLH1 (mGFP-tagged) - Human folate hydrolase (prostate-specific membrane antigen) 1 (FOLH1), transcript variant 1, 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP |
Tag | mGFP |
FOLH1 (GFP-tagged) - Human folate hydrolase (prostate-specific membrane antigen) 1 (FOLH1), transcript variant 1
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
Lenti ORF clone of Human folate hydrolase (prostate-specific membrane antigen) 1 (FOLH1), transcript variant 5, mGFP tagged
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
FOLH1 (Myc-DDK-tagged)-Human folate hydrolase (prostate-specific membrane antigen) 1 (FOLH1), transcript variant 3
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
USD 1,010.00
2 Weeks
Lenti ORF particles, FOLH1 (mGFP-tagged) - Human folate hydrolase (prostate-specific membrane antigen) 1 (FOLH1), transcript variant 1, 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
USD 820.00
3 Weeks
Lenti ORF particles, FOLH1 (Myc-DDK tagged) - Human folate hydrolase (prostate-specific membrane antigen) 1 (FOLH1), transcript variant 5, 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF clone of Human folate hydrolase (prostate-specific membrane antigen) 1 (FOLH1), transcript variant 2, Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
USD 1,010.00
5 Weeks
Lenti ORF particles, FOLH1 (Myc-DDK tagged) - Human folate hydrolase (prostate-specific membrane antigen) 1 (FOLH1), transcript variant 2, 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
USD 1,010.00
3 Weeks
Lenti ORF particles, FOLH1 (mGFP-tagged) - Human folate hydrolase (prostate-specific membrane antigen) 1 (FOLH1), transcript variant 2, 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
FOLH1 (Myc-DDK-tagged)-Human folate hydrolase (prostate-specific membrane antigen) 1 (FOLH1), transcript variant 4
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
Lenti-ORF clone of FOLH1 (Myc-DDK-tagged)-Human folate hydrolase (prostate-specific membrane antigen) 1 (FOLH1), transcript variant 4
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
USD 1,010.00
7 Weeks
Lenti ORF particles, FOLH1 (Myc-DDK-tagged)-Human folate hydrolase (prostate-specific membrane antigen) 1 (FOLH1), transcript variant 4, 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti-ORF clone of FOLH1 (mGFP-tagged)-Human folate hydrolase (prostate-specific membrane antigen) 1 (FOLH1), transcript variant 4
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
USD 1,010.00
7 Weeks
Lenti ORF particles, FOLH1 (mGFP-tagged)-Human folate hydrolase (prostate-specific membrane antigen) 1 (FOLH1), transcript variant 4, 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti-ORF clone of FOLH1 (Myc-DDK-tagged)-Human folate hydrolase (prostate-specific membrane antigen) 1 (FOLH1), transcript variant 3
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
USD 1,210.00
6 Weeks
Lenti ORF particles, FOLH1 (Myc-DDK-tagged)-Human folate hydrolase (prostate-specific membrane antigen) 1 (FOLH1), transcript variant 3, 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
USD 1,210.00
3 Weeks
Lenti ORF particles, FOLH1 (mGFP-tagged)-Human folate hydrolase (prostate-specific membrane antigen) 1 (FOLH1), transcript variant 3, 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
FOLH1 (GFP-tagged) - Human folate hydrolase (prostate-specific membrane antigen) 1 (FOLH1), transcript variant 5
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
FOLH1 (GFP-tagged) - Human folate hydrolase (prostate-specific membrane antigen) 1 (FOLH1), transcript variant 4
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
FOLH1 (GFP-tagged) - Human folate hydrolase (prostate-specific membrane antigen) 1 (FOLH1), transcript variant 3
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
FOLH1 (untagged)-Human folate hydrolase (prostate-specific membrane antigen) 1 (FOLH1), transcript variant 1
Vector | pCMV6-XL5 |
Tag | Tag Free |
Mammalian Cell Selection | None |
PSMA (FOLH1) (44-750) mouse monoclonal antibody, clone GCP-05, PE
Applications | FC |
Reactivities | Human |
Conjugation | PE |
Transient overexpression lysate of folate hydrolase (prostate-specific membrane antigen) 1 (FOLH1), transcript variant 1
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
Lenti ORF clone of Human folate hydrolase (prostate-specific membrane antigen) 1 (FOLH1), transcript variant 1, mGFP tagged
Vector | pLenti-C-mGFP |
Tag | mGFP |
Mammalian Cell Selection | None |
Lenti-ORF clone of FOLH1 (mGFP-tagged)-Human folate hydrolase (prostate-specific membrane antigen) 1 (FOLH1), transcript variant 3
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti ORF clone of Human folate hydrolase (prostate-specific membrane antigen) 1 (FOLH1), transcript variant 2, Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK |
Tag | Myc-DDK |
Mammalian Cell Selection | None |
Transient overexpression lysate of folate hydrolase (prostate-specific membrane antigen) 1 (FOLH1), transcript variant 2
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
PSMA (FOLH1) mouse monoclonal antibody, clone Y-PSMA2, Purified
Applications | ELISA, IF, IHC, WB |
Reactivities | Human |
Rabbit monoclonal antibody against PSMA (EP3253 )
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Lenti ORF clone of Human folate hydrolase (prostate-specific membrane antigen) 1 (FOLH1), transcript variant 2, mGFP tagged
Vector | pLenti-C-mGFP |
Tag | mGFP |
Mammalian Cell Selection | None |
FOLH1 (untagged)-Human folate hydrolase (prostate-specific membrane antigen) 1 (FOLH1), transcript variant 2
Vector | pCMV6-XL5 |
Tag | Tag Free |
Mammalian Cell Selection | None |
PSMA (FOLH1) mouse monoclonal antibody, clone 4H11, Aff - Purified
Applications | ELISA, IHC |
Reactivities | Human |
Conjugation | Unconjugated |
FOLH1 HEK293T cell transient overexpression lysate (as WB positive control)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
FOLH1 HEK293T cell transient overexpression lysate (as WB positive control)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
FOLH1 HEK293T cell transient overexpression lysate (as WB positive control)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
PSMA (FOLH1) mouse monoclonal antibody, clone 7F3, Aff - Purified
Applications | ELISA |
Reactivities | Human |
Conjugation | Unconjugated |
Rabbit Polyclonal Anti-FOLH1 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-FOLH1 Antibody: synthetic peptide directed towards the C terminal of human FOLH1. Synthetic peptide located within the following region: FYRHVIYAPSSHNKYAGESFPGIYDALFDIESKVDPSKAWGEVKRQIYVA |
Rabbit Polyclonal Anti-FOLH1 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-FOLH1 Antibody is: synthetic peptide directed towards the middle region of Human FOLH1. Synthetic peptide located within the following region: FSGMPRISKLGSGNDFEVFFQRLGIASGRARYTKNWETNKFSGYPLYHSV |
Carrier-free (BSA/glycerol-free) FOLH1 mouse monoclonal antibody, clone OTI2E1 (formerly 2E1)
Applications | ELISA, IF, WB |
Reactivities | Human, Monkey, Mouse, Rat, Dog |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) FOLH1 mouse monoclonal antibody, clone OTI5A9 (formerly 5A9)
Applications | FC, WB |
Reactivities | Human |
Conjugation | Unconjugated |