Products

Antibodies (66)
cDNA Clones (35)
Proteins (21)
Jump to Filters
View as table Download
PSMA (FOLH1) (NM_004476) Human Tagged ORF Clone
RC218310

USD 610.00

In Stock

FOLH1 (Myc-DDK-tagged)-Human folate hydrolase (prostate-specific membrane antigen) 1 (FOLH1), transcript variant 1

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
PSMA (FOLH1) (NM_004476) Human Tagged ORF Clone Lentiviral Particle
RC218310L3V

USD 1,248.00

3 Weeks

Lenti ORF particles, FOLH1 (Myc-DDK tagged) - Human folate hydrolase (prostate-specific membrane antigen) 1 (FOLH1), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
PSMA (FOLH1) (NM_001014986) Human Tagged ORF Clone
RC206548

USD 610.00

In Stock

FOLH1 (Myc-DDK-tagged)-Human folate hydrolase (prostate-specific membrane antigen) 1 (FOLH1), transcript variant 2

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
PSMA (FOLH1) (NM_001193473) Human Tagged ORF Clone Lentiviral Particle
RC231234L4V

USD 1,020.00

2 Weeks

Lenti ORF particles, FOLH1 (mGFP-tagged) - Human folate hydrolase (prostate-specific membrane antigen) 1 (FOLH1), transcript variant 5, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
PSMA (FOLH1) (NM_001193473) Human Tagged ORF Clone
RC231234

USD 420.00

In Stock

FOLH1 (Myc-DDK-tagged)-Human folate hydrolase (prostate-specific membrane antigen) 1 (FOLH1), transcript variant 5

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
PSMA (FOLH1) (NM_001014986) Human Tagged ORF Clone Lentiviral Particle
RC206548L1V

USD 1,010.00

3 Weeks

Lenti ORF particles, FOLH1 (Myc-DDK tagged) - Human folate hydrolase (prostate-specific membrane antigen) 1 (FOLH1), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
  • LentiORF®
PSMA (FOLH1) (NM_004476) Human Tagged ORF Clone Lentiviral Particle
RC218310L1V

USD 1,010.00

In Stock

Lenti ORF particles, FOLH1 (Myc-DDK tagged) - Human folate hydrolase (prostate-specific membrane antigen) 1 (FOLH1), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
  • LentiORF®
PSMA (FOLH1) (NM_001014986) Human Tagged ORF Clone
RG206548

USD 670.00

In Stock

FOLH1 (GFP-tagged) - Human folate hydrolase (prostate-specific membrane antigen) 1 (FOLH1), transcript variant 2

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
PSMA (FOLH1) (NM_001014986) Human Tagged ORF Clone Lentiviral Particle
RC206548L2V

USD 1,010.00

6 Weeks

Lenti ORF particles, FOLH1 (mGFP-tagged) - Human folate hydrolase (prostate-specific membrane antigen) 1 (FOLH1), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP
Tag mGFP
  • LentiORF®
PSMA (FOLH1) (NM_004476) Human Tagged ORF Clone Lentiviral Particle
RC218310L2V

USD 1,010.00

3 Weeks

Lenti ORF particles, FOLH1 (mGFP-tagged) - Human folate hydrolase (prostate-specific membrane antigen) 1 (FOLH1), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP
Tag mGFP
  • LentiORF®
PSMA (FOLH1) (NM_004476) Human Tagged ORF Clone
RG218310

USD 670.00

In Stock

FOLH1 (GFP-tagged) - Human folate hydrolase (prostate-specific membrane antigen) 1 (FOLH1), transcript variant 1

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
PSMA (FOLH1) (NM_001193473) Human Tagged ORF Clone
RC231234L4

USD 620.00

In Stock

Lenti ORF clone of Human folate hydrolase (prostate-specific membrane antigen) 1 (FOLH1), transcript variant 5, mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
PSMA (FOLH1) (NM_001193471) Human Tagged ORF Clone
RC231396

USD 810.00

In Stock

FOLH1 (Myc-DDK-tagged)-Human folate hydrolase (prostate-specific membrane antigen) 1 (FOLH1), transcript variant 3

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
PSMA (FOLH1) (NM_004476) Human Tagged ORF Clone Lentiviral Particle
RC218310L4V

USD 1,010.00

2 Weeks

Lenti ORF particles, FOLH1 (mGFP-tagged) - Human folate hydrolase (prostate-specific membrane antigen) 1 (FOLH1), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
PSMA (FOLH1) (NM_001193473) Human Tagged ORF Clone Lentiviral Particle
RC231234L3V

USD 820.00

3 Weeks

Lenti ORF particles, FOLH1 (Myc-DDK tagged) - Human folate hydrolase (prostate-specific membrane antigen) 1 (FOLH1), transcript variant 5, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
PSMA (FOLH1) (NM_001014986) Human Tagged ORF Clone
RC206548L3

USD 810.00

3 Weeks

Lenti ORF clone of Human folate hydrolase (prostate-specific membrane antigen) 1 (FOLH1), transcript variant 2, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
PSMA (FOLH1) (NM_001014986) Human Tagged ORF Clone Lentiviral Particle
RC206548L3V

USD 1,010.00

5 Weeks

Lenti ORF particles, FOLH1 (Myc-DDK tagged) - Human folate hydrolase (prostate-specific membrane antigen) 1 (FOLH1), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
PSMA (FOLH1) (NM_001014986) Human Tagged ORF Clone Lentiviral Particle
RC206548L4V

USD 1,010.00

3 Weeks

Lenti ORF particles, FOLH1 (mGFP-tagged) - Human folate hydrolase (prostate-specific membrane antigen) 1 (FOLH1), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
PSMA (FOLH1) (NM_001193472) Human Tagged ORF Clone
RC231383

USD 610.00

3 Weeks

FOLH1 (Myc-DDK-tagged)-Human folate hydrolase (prostate-specific membrane antigen) 1 (FOLH1), transcript variant 4

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
PSMA (FOLH1) (NM_001193472) Human Tagged ORF Clone
RC231383L3

USD 810.00

4 Weeks

Lenti-ORF clone of FOLH1 (Myc-DDK-tagged)-Human folate hydrolase (prostate-specific membrane antigen) 1 (FOLH1), transcript variant 4

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
PSMA (FOLH1) (NM_001193472) Human Tagged ORF Clone Lentiviral Particle
RC231383L3V

USD 1,010.00

7 Weeks

Lenti ORF particles, FOLH1 (Myc-DDK-tagged)-Human folate hydrolase (prostate-specific membrane antigen) 1 (FOLH1), transcript variant 4, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
PSMA (FOLH1) (NM_001193472) Human Tagged ORF Clone
RC231383L4

USD 810.00

4 Weeks

Lenti-ORF clone of FOLH1 (mGFP-tagged)-Human folate hydrolase (prostate-specific membrane antigen) 1 (FOLH1), transcript variant 4

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
PSMA (FOLH1) (NM_001193472) Human Tagged ORF Clone Lentiviral Particle
RC231383L4V

USD 1,010.00

7 Weeks

Lenti ORF particles, FOLH1 (mGFP-tagged)-Human folate hydrolase (prostate-specific membrane antigen) 1 (FOLH1), transcript variant 4, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
PSMA (FOLH1) (NM_001193471) Human Tagged ORF Clone
RC231396L3

USD 1,010.00

3 Weeks

Lenti-ORF clone of FOLH1 (Myc-DDK-tagged)-Human folate hydrolase (prostate-specific membrane antigen) 1 (FOLH1), transcript variant 3

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
PSMA (FOLH1) (NM_001193471) Human Tagged ORF Clone Lentiviral Particle
RC231396L3V

USD 1,210.00

6 Weeks

Lenti ORF particles, FOLH1 (Myc-DDK-tagged)-Human folate hydrolase (prostate-specific membrane antigen) 1 (FOLH1), transcript variant 3, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
PSMA (FOLH1) (NM_001193471) Human Tagged ORF Clone Lentiviral Particle
RC231396L4V

USD 1,210.00

3 Weeks

Lenti ORF particles, FOLH1 (mGFP-tagged)-Human folate hydrolase (prostate-specific membrane antigen) 1 (FOLH1), transcript variant 3, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
PSMA (FOLH1) (NM_001193473) Human Tagged ORF Clone
RG231234

USD 460.00

3 Weeks

FOLH1 (GFP-tagged) - Human folate hydrolase (prostate-specific membrane antigen) 1 (FOLH1), transcript variant 5

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
PSMA (FOLH1) (NM_001193472) Human Tagged ORF Clone
RG231383

USD 670.00

5 Weeks

FOLH1 (GFP-tagged) - Human folate hydrolase (prostate-specific membrane antigen) 1 (FOLH1), transcript variant 4

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
PSMA (FOLH1) (NM_001193471) Human Tagged ORF Clone
RG231396

USD 890.00

3 Weeks

FOLH1 (GFP-tagged) - Human folate hydrolase (prostate-specific membrane antigen) 1 (FOLH1), transcript variant 3

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
PSMA (FOLH1) (NM_004476) Human Untagged Clone
SC117383

USD 1,510.00

In Stock

FOLH1 (untagged)-Human folate hydrolase (prostate-specific membrane antigen) 1 (FOLH1), transcript variant 1

Vector pCMV6-XL5
Tag Tag Free
Mammalian Cell Selection None
PSMA (FOLH1) (NM_004476) Human Over-expression Lysate
LY417950

USD 605.00

2 Weeks

Transient overexpression lysate of folate hydrolase (prostate-specific membrane antigen) 1 (FOLH1), transcript variant 1

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
LY417950 is the same product as LY429203.
PSMA (FOLH1) (NM_004476) Human Tagged ORF Clone
RC218310L2

USD 1,008.00

In Stock

Lenti ORF clone of Human folate hydrolase (prostate-specific membrane antigen) 1 (FOLH1), transcript variant 1, mGFP tagged

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®
PSMA (FOLH1) (NM_001193471) Human Tagged ORF Clone
RC231396L4

USD 1,248.00

In Stock

Lenti-ORF clone of FOLH1 (mGFP-tagged)-Human folate hydrolase (prostate-specific membrane antigen) 1 (FOLH1), transcript variant 3

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
PSMA (FOLH1) (NM_001014986) Human Tagged ORF Clone
RC206548L1

USD 810.00

In Stock

Lenti ORF clone of Human folate hydrolase (prostate-specific membrane antigen) 1 (FOLH1), transcript variant 2, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
Mammalian Cell Selection None
  • LentiORF®
PSMA (FOLH1) (NM_001014986) Human Over-expression Lysate
LY423102

USD 396.00

5 Days

Transient overexpression lysate of folate hydrolase (prostate-specific membrane antigen) 1 (FOLH1), transcript variant 2

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
PSMA (FOLH1) Mouse Monoclonal Antibody [Clone ID: Y-PSMA2]
AM20502PU-N

USD 440.00

2 Weeks

PSMA (FOLH1) mouse monoclonal antibody, clone Y-PSMA2, Purified

Applications ELISA, IF, IHC, WB
Reactivities Human
PSMA (FOLH1) Rabbit Monoclonal Antibody [Clone ID: EP3253]
TA303519

USD 508.00

In Stock

Rabbit monoclonal antibody against PSMA (EP3253 )

Applications WB
Reactivities Human
Conjugation Unconjugated
PSMA (FOLH1) (NM_001014986) Human Tagged ORF Clone
RC206548L2

USD 810.00

3 Weeks

Lenti ORF clone of Human folate hydrolase (prostate-specific membrane antigen) 1 (FOLH1), transcript variant 2, mGFP tagged

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®
PSMA (FOLH1) (NM_001014986) Human Untagged Clone
SC301976

USD 760.00

In Stock

FOLH1 (untagged)-Human folate hydrolase (prostate-specific membrane antigen) 1 (FOLH1), transcript variant 2

Vector pCMV6-XL5
Tag Tag Free
Mammalian Cell Selection None
PSMA (FOLH1) Mouse Monoclonal Antibody [Clone ID: 4H11]
AM09256PU-N

USD 485.00

2 Weeks

PSMA (FOLH1) mouse monoclonal antibody, clone 4H11, Aff - Purified

Applications ELISA, IHC
Reactivities Human
Conjugation Unconjugated
PSMA (FOLH1) (NM_004476) Human Over-expression Lysate
LC417950

USD 187.00

In Stock

FOLH1 HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
PSMA (FOLH1) (NM_001014986) Human Over-expression Lysate
LC423102

USD 121.00

In Stock

FOLH1 HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
PSMA (FOLH1) (NM_004476) Human Over-expression Lysate
LC429203

USD 187.00

In Stock

FOLH1 HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
PSMA (FOLH1) Mouse Monoclonal Antibody [Clone ID: 7F3]
AM09257PU-N

USD 485.00

2 Weeks

PSMA (FOLH1) mouse monoclonal antibody, clone 7F3, Aff - Purified

Applications ELISA
Reactivities Human
Conjugation Unconjugated
PSMA (FOLH1) Rabbit Polyclonal Antibody
TA335746

USD 375.00

5 Days

Rabbit Polyclonal Anti-FOLH1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-FOLH1 Antibody: synthetic peptide directed towards the C terminal of human FOLH1. Synthetic peptide located within the following region: FYRHVIYAPSSHNKYAGESFPGIYDALFDIESKVDPSKAWGEVKRQIYVA
PSMA (FOLH1) Rabbit Polyclonal Antibody
TA336088

USD 375.00

5 Days

Rabbit Polyclonal Anti-FOLH1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-FOLH1 Antibody is: synthetic peptide directed towards the middle region of Human FOLH1. Synthetic peptide located within the following region: FSGMPRISKLGSGNDFEVFFQRLGIASGRARYTKNWETNKFSGYPLYHSV
PSMA (FOLH1) Mouse Monoclonal Antibody [Clone ID: OTI2E1]
CF504509

USD 465.00

In Stock

Carrier-free (BSA/glycerol-free) FOLH1 mouse monoclonal antibody, clone OTI2E1 (formerly 2E1)

Applications ELISA, IF, WB
Reactivities Human, Monkey, Mouse, Rat, Dog
Conjugation Unconjugated
PSMA (FOLH1) Mouse Monoclonal Antibody [Clone ID: OTI5A9]
CF504549

USD 465.00

4 Weeks

Carrier-free (BSA/glycerol-free) FOLH1 mouse monoclonal antibody, clone OTI5A9 (formerly 5A9)

Applications FC, WB
Reactivities Human
Conjugation Unconjugated