Products

cDNA Clones (25)
Proteins (16)
Antibodies (3)
Jump to Filters
View as table Download
PSMB5 (NM_002797) Human Tagged ORF Clone
RC209326

USD 98.00

USD 390.00

In Stock

PSMB5 (Myc-DDK-tagged)-Human proteasome (prosome, macropain) subunit, beta type, 5 (PSMB5), transcript variant 1

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
PSMB5 (NM_001130725) Human Tagged ORF Clone
RC225146

USD 420.00

In Stock

PSMB5 (Myc-DDK-tagged)-Human proteasome (prosome, macropain) subunit, beta type, 5 (PSMB5), transcript variant 2

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
PSMB5 (NM_002797) Human Tagged ORF Clone Lentiviral Particle
RC209326L2V

USD 820.00

6 Weeks

Lenti ORF particles, PSMB5 (mGFP-tagged) - Human proteasome (prosome, macropain) subunit, beta type, 5 (PSMB5), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP
Tag mGFP
  • LentiORF®
PSMB5 (NM_002797) Human Tagged ORF Clone
RC209326L4

USD 620.00

In Stock

Lenti ORF clone of Human proteasome (prosome, macropain) subunit, beta type, 5 (PSMB5), transcript variant 1, mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
PSMB5 (NM_002797) Human Tagged ORF Clone
RG209326

USD 460.00

In Stock

PSMB5 (GFP-tagged) - Human proteasome (prosome, macropain) subunit, beta type, 5 (PSMB5), transcript variant 1

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
PSMB5 (NM_002797) Human Tagged ORF Clone
RC209326L3

USD 620.00

3 Weeks

Lenti ORF clone of Human proteasome (prosome, macropain) subunit, beta type, 5 (PSMB5), transcript variant 1, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
PSMB5 (NM_002797) Human Tagged ORF Clone Lentiviral Particle
RC209326L3V

USD 820.00

5 Weeks

Lenti ORF particles, PSMB5 (Myc-DDK tagged) - Human proteasome (prosome, macropain) subunit, beta type, 5 (PSMB5), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
PSMB5 (NM_002797) Human Tagged ORF Clone Lentiviral Particle
RC209326L4V

USD 820.00

3 Weeks

Lenti ORF particles, PSMB5 (mGFP-tagged) - Human proteasome (prosome, macropain) subunit, beta type, 5 (PSMB5), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
PSMB5 (NM_001130725) Human Tagged ORF Clone
RC225146L3

USD 620.00

3 Weeks

Lenti ORF clone of Human proteasome (prosome, macropain) subunit, beta type, 5 (PSMB5), transcript variant 2, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
PSMB5 (NM_001130725) Human Tagged ORF Clone Lentiviral Particle
RC225146L3V

USD 820.00

6 Weeks

Lenti ORF particles, PSMB5 (Myc-DDK tagged) - Human proteasome (prosome, macropain) subunit, beta type, 5 (PSMB5), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
PSMB5 (NM_001130725) Human Tagged ORF Clone
RC225146L4

USD 620.00

3 Weeks

Lenti ORF clone of Human proteasome (prosome, macropain) subunit, beta type, 5 (PSMB5), transcript variant 2, mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
PSMB5 (NM_001130725) Human Tagged ORF Clone Lentiviral Particle
RC225146L4V

USD 820.00

6 Weeks

Lenti ORF particles, PSMB5 (mGFP-tagged) - Human proteasome (prosome, macropain) subunit, beta type, 5 (PSMB5), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
PSMB5 (NM_001144932) Human Tagged ORF Clone
RC227745

USD 420.00

3 Weeks

PSMB5 (Myc-DDK-tagged)-Human proteasome (prosome, macropain) subunit, beta type, 5 (PSMB5), transcript variant 3

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
PSMB5 (NM_001144932) Human Tagged ORF Clone
RC227745L3

USD 620.00

8 Weeks

Lenti-ORF clone of PSMB5 (Myc-DDK-tagged)-Human proteasome (prosome, macropain) subunit, beta type, 5 (PSMB5), transcript variant 3

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
PSMB5 (NM_001144932) Human Tagged ORF Clone Lentiviral Particle
RC227745L3V

USD 820.00

11 Weeks

Lenti ORF particles, PSMB5 (Myc-DDK-tagged)-Human proteasome (prosome, macropain) subunit, beta type, 5 (PSMB5), transcript variant 3, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
PSMB5 (NM_001144932) Human Tagged ORF Clone
RC227745L4

USD 620.00

8 Weeks

Lenti-ORF clone of PSMB5 (mGFP-tagged)-Human proteasome (prosome, macropain) subunit, beta type, 5 (PSMB5), transcript variant 3

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
PSMB5 (NM_001144932) Human Tagged ORF Clone Lentiviral Particle
RC227745L4V

USD 820.00

11 Weeks

Lenti ORF particles, PSMB5 (mGFP-tagged)-Human proteasome (prosome, macropain) subunit, beta type, 5 (PSMB5), transcript variant 3, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
PSMB5 (NM_001130725) Human Tagged ORF Clone
RG225146

USD 460.00

3 Weeks

PSMB5 (GFP-tagged) - Human proteasome (prosome, macropain) subunit, beta type, 5 (PSMB5), transcript variant 2

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
PSMB5 (NM_001144932) Human Tagged ORF Clone
RG227745

USD 460.00

3 Weeks

PSMB5 (GFP-tagged) - Human proteasome (prosome, macropain) subunit, beta type, 5 (PSMB5), transcript variant 3

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
PSMB5 Rabbit Polyclonal Antibody
TA332481

USD 275.00

3 Weeks

Rabbit anti-PSMB5 Polyclonal Antibody

Applications ICC/IF, IP, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human PSMB5
PSMB5 (NM_002797) Human Tagged ORF Clone Lentiviral Particle
RC209326L1V

USD 1,020.00

3 Weeks

Lenti ORF particles, PSMB5 (Myc-DDK tagged) - Human proteasome (prosome, macropain) subunit, beta type, 5 (PSMB5), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
Mammalian Cell Selection None
  • LentiORF®
PSMB5 (NM_002797) Human Tagged ORF Clone
RC209326L1

USD 768.00

In Stock

Lenti ORF clone of Human proteasome (prosome, macropain) subunit, beta type, 5 (PSMB5), transcript variant 1, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
Mammalian Cell Selection None
  • LentiORF®
PSMB5 (NM_002797) Human Over-expression Lysate
LY400989

USD 396.00

5 Days

Transient overexpression lysate of proteasome (prosome, macropain) subunit, beta type, 5 (PSMB5), transcript variant 1

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
PSMB5 (NM_001130725) Human Over-expression Lysate
LC427268

USD 121.00

In Stock

PSMB5 HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
PSMB5 (NM_002797) Human Tagged ORF Clone
RC209326L2

USD 620.00

3 Weeks

Lenti ORF clone of Human proteasome (prosome, macropain) subunit, beta type, 5 (PSMB5), transcript variant 1, mGFP tagged

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®
PSMB5 (NM_002797) Human Untagged Clone
SC320115

USD 310.00

In Stock

PSMB5 (untagged)-Human proteasome (prosome, macropain) subunit, beta type, 5 (PSMB5), transcript variant 1

Vector pCMV6-XL5
Tag Tag Free
Mammalian Cell Selection None
PSMB5 Goat Polyclonal Antibody
AP22975PU-N

USD 440.00

2 Weeks

PSMB5 goat polyclonal antibody, Aff - Purified

Applications IHC
Reactivities Bat, Bovine, Canine, Equine, Hamster, Human, Monkey, Mouse, Porcine, Rabbit, Rat, Xenopus, Zebrafish
Immunogen PSMB5 antibody was raised against synthetic peptide from human PSMB5 / MB1
PSMB5 Rabbit Polyclonal Antibody
TA342169

USD 375.00

5 Days

Rabbit polyclonal Anti-PSMB5 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PSMB5 antibody: synthetic peptide directed towards the middle region of human PSMB5. Synthetic peptide located within the following region: IVAADSRATAGAYIASQTVKKVIEINPYLLGTMAGGAADCSFWERLLARQ
PSMB5 (60-263, His-tag) Human Protein
AR09790PU-L

USD 1,105.00

2 Weeks

PSMB5 (60-263, His-tag) human recombinant protein, 0.25 mg

Tag His-tag
Expression Host E. coli
PSMB5 (60-263, His-tag) Human Protein
AR09790PU-N

USD 415.00

2 Weeks

PSMB5 (60-263, His-tag) human recombinant protein, 50 µg

Tag His-tag
Expression Host E. coli
PSMB5 (NM_002797) Human Over-expression Lysate
LC400989

USD 121.00

2 Weeks

PSMB5 HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
PSMB5 (NM_001130725) Human Over-expression Lysate
LY427268

USD 396.00

5 Days

Transient overexpression lysate of proteasome (prosome, macropain) subunit, beta type, 5 (PSMB5), transcript variant 2

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
PSMB5 (NM_002797) Human Mass Spec Standard
PH309326

USD 2,055.00

3 Weeks

PSMB5 MS Standard C13 and N15-labeled recombinant protein (NP_002788)

Tag C-Myc/DDK
Expression Host HEK293
PSMB5 (NM_001130725) Human Untagged Clone
SC324749

USD 420.00

3 Weeks

PSMB5 (untagged)-Human proteasome (prosome, macropain) subunit, beta type, 5 (PSMB5), transcript variant 2

Vector pCMV6-Entry
Tag Tag Free
Mammalian Cell Selection Neomycin
PSMB5 (NM_001144932) Human Untagged Clone
SC325599

USD 420.00

3 Weeks

PSMB5 (untagged)-Human proteasome (prosome, macropain) subunit, beta type, 5 (PSMB5), transcript variant 3

Vector pCMV6 series
Tag Tag Free
PSMB5 ICC Control Block
TB409326

USD 1,040.00

4 Weeks

Transient overexpression of PSMB5 (NM_002797) in HEK293T cells paraffin embedded controls for ICC/IHC staining

PSMB5 ICC Control Block
TB425146

USD 1,070.00

4 Weeks

Transient overexpression of PSMB5 (NM_001130725) in HEK293T cells paraffin embedded controls for ICC/IHC staining

PSMB5 ICC Control Block
TB427745

USD 1,070.00

4 Weeks

Transient overexpression of PSMB5 (NM_001144932) in HEK293T cells paraffin embedded controls for ICC/IHC staining

PSMB5 Cytosection
TS409326

USD 225.00

4 Weeks

Transient overexpression of PSMB5 (NM_002797) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

PSMB5 Cytosection
TS409326P5

USD 889.00

4 Weeks

Transient overexpression of PSMB5 (NM_002797) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack

PSMB5 Cytosection
TS425146

USD 225.00

4 Weeks

Transient overexpression of PSMB5 (NM_001130725) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

PSMB5 Cytosection
TS425146P5

USD 889.00

4 Weeks

Transient overexpression of PSMB5 (NM_001130725) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack

PSMB5 ICC Control Sections
TS427745P5

USD 889.00

4 Weeks

Transient overexpression of PSMB5 (NM_001144932) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack