DAPK1 (Myc-DDK-tagged)-Human death-associated protein kinase 1 (DAPK1)
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
DAPK1 (Myc-DDK-tagged)-Human death-associated protein kinase 1 (DAPK1)
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
USD 1,000.00
3 Weeks
Lenti ORF particles, DAPK1 (Myc-DDK tagged) - Human death-associated protein kinase 1 (DAPK1), 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK |
Tag | Myc-DDK |
USD 1,000.00
3 Weeks
Lenti ORF particles, DAPK1 (mGFP-tagged) - Human death-associated protein kinase 1 (DAPK1), 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP |
Tag | mGFP |
DAPK1 (GFP-tagged) - Human death-associated protein kinase 1 (DAPK1)
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
Rabbit polyclonal DAPK1 Antibody (C-term)
Applications | IF, IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | This DAPK1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 1360-1389 amino acids from the C-terminal region of human DAPK1. |
Lenti ORF clone of Human death-associated protein kinase 1 (DAPK1), Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
USD 1,000.00
5 Weeks
Lenti ORF particles, DAPK1 (Myc-DDK tagged) - Human death-associated protein kinase 1 (DAPK1), 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF clone of Human death-associated protein kinase 1 (DAPK1), mGFP tagged
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
USD 1,000.00
3 Weeks
Lenti ORF particles, DAPK1 (mGFP-tagged) - Human death-associated protein kinase 1 (DAPK1), 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
DAPK1 (myc-DDK-tagged) - Human death-associated protein kinase 1 (DAPK1), transcript variant 2
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
DAPK1 (myc-DDK-tagged) - Human death-associated protein kinase 1 (DAPK1), transcript variant 3
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
DAPK1 (myc-DDK-tagged) - Human death-associated protein kinase 1 (DAPK1), transcript variant 4
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
DAPK1 (untagged)-Human death-associated protein kinase 1 (DAPK1)
Vector | pCMV6-XL4 |
Tag | Tag Free |
Mammalian Cell Selection | None |
Lenti ORF clone of Human death-associated protein kinase 1 (DAPK1), Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK |
Tag | Myc-DDK |
Mammalian Cell Selection | None |
Rabbit Polyclonal Anti-DAPK1 Antibody - N-terminal region
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-DAPK1 antibody: synthetic peptide directed towards the N terminal of human DAPK1. Synthetic peptide located within the following region: MTVFRQENVDDYYDTGEELGSGQFAVVKKCREKSTGLQYAAKFIKKRRTK |
DAPK1 HEK293T cell transient overexpression lysate (as WB positive control)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
Transient overexpression lysate of death-associated protein kinase 1 (DAPK1)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
Rabbit anti-DAPK1 Polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human DAPK1 |
DAPK1 (untagged)-Kinase deficient mutant (K42M) of Human death-associated protein kinase 1 (DAPK1)
Vector | pCMV6-XL5 |
Tag | Tag Free |
Mammalian Cell Selection | None |
Rabbit Polyclonal DAP Kinase 1 Antibody
Applications | ELISA |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | DNA immunization. This antibody is specific for the C Terminus Region of the target protein. |
DAPK1 MS Standard C13 and N15-labeled recombinant protein (NP_004929)
Tag | C-Myc/DDK |
Expression Host | HEK293 |
DAPK1 (GFP-tagged) - Human death-associated protein kinase 1 (DAPK1), transcript variant 2
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
DAPK1 (GFP-tagged) - Human death-associated protein kinase 1 (DAPK1), transcript variant 3
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
DAPK1 (GFP-tagged) - Human death-associated protein kinase 1 (DAPK1), transcript variant 4
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
DAPK1 (untagged) - Human death-associated protein kinase 1 (DAPK1), transcript variant 2
Vector | pCMV6 series |
Tag | Tag Free |
DAPK1 (untagged) - Human death-associated protein kinase 1 (DAPK1), transcript variant 3
Vector | pCMV6 series |
Tag | Tag Free |
DAPK1 (untagged) - Human death-associated protein kinase 1 (DAPK1), transcript variant 4
Vector | pCMV6 series |
Tag | Tag Free |
Transient overexpression of DAPK1 (NM_004938) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of DAPK1 (NM_001288729) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of DAPK1 (NM_001288730) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of DAPK1 (NM_001288731) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of DAPK1 (NM_004938) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of DAPK1 (NM_004938) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Transient overexpression of DAPK1 (NM_001288729) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Transient overexpression of DAPK1 (NM_001288730) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Transient overexpression of DAPK1 (NM_001288731) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack