Germany
Japan
United Kingdom
China
CSK (Myc-DDK-tagged)-Human c-src tyrosine kinase (CSK), transcript variant 1
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
Products
View as table Download
CSK (Myc-DDK-tagged)-Human c-src tyrosine kinase (CSK), transcript variant 2
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
Lenti ORF particles, CSK (Myc-DDK tagged) - Human c-src tyrosine kinase (CSK), transcript variant 1, 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
- LentiORF®
-
Lenti ORF particles, CSK (mGFP-tagged) - Human c-src tyrosine kinase (CSK), transcript variant 1, 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
- LentiORF®
-
CSK (GFP-tagged) - Human c-src tyrosine kinase (CSK), transcript variant 1
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti ORF clone of Human c-src tyrosine kinase (CSK), transcript variant 1, Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, CSK (Myc-DDK tagged) - Human c-src tyrosine kinase (CSK), transcript variant 1, 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human c-src tyrosine kinase (CSK), transcript variant 1, mGFP tagged
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, CSK (mGFP-tagged) - Human c-src tyrosine kinase (CSK), transcript variant 1, 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human c-src tyrosine kinase (CSK), transcript variant 2, Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, CSK (Myc-DDK tagged) - Human c-src tyrosine kinase (CSK), transcript variant 2, 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human c-src tyrosine kinase (CSK), transcript variant 2, mGFP tagged
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, CSK (mGFP-tagged) - Human c-src tyrosine kinase (CSK), transcript variant 2, 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
CSK (GFP-tagged) - Human c-src tyrosine kinase (CSK), transcript variant 2
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
CSK (untagged)-Human c-src tyrosine kinase (CSK), transcript variant 1
| Vector | pCMV6-XL4 |
| Tag | Tag Free |
| Mammalian Cell Selection | None |
Lenti ORF clone of Human c-src tyrosine kinase (CSK), transcript variant 1, Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
| Mammalian Cell Selection | None |
- LentiORF®
CSK (untagged)-Kinase deficient mutant (K222M) of Human c-src tyrosine kinase (CSK), transcript variant 1
| Vector | pCMV6-XL5 |
| Tag | Tag Free |
| Mammalian Cell Selection | None |
Lenti ORF clone of Human c-src tyrosine kinase (CSK), transcript variant 1, mGFP tagged
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
| Mammalian Cell Selection | None |
- LentiORF®
CSK rabbit polyclonal antibody, Aff - Purified
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
CSK HEK293T cell transient overexpression lysate (as WB positive control)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
CSK HEK293T cell transient overexpression lysate (as WB positive control)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Transient overexpression lysate of c-src tyrosine kinase (CSK), transcript variant 1
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Special Offer: Get a 20% discount on this product. Use code: "OEL20".
Goat Polyclonal Antibody against CSK
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-EQLEHIKTHELHL, from the C Terminus of the protein sequence according to NP_004374.1. |
Transient overexpression lysate of c-src tyrosine kinase (CSK), transcript variant 2
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Special Offer: Get a 20% discount on this product. Use code: "OEL20".
Rabbit Polyclonal Anti-CSK Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CSK antibody: synthetic peptide directed towards the middle region of human CSK. Synthetic peptide located within the following region: SEDNVAKVSDFGLTKEASSTQDTGKLPVKWTAPEALREKKFSTKSDVWSF |
CSK (1-450, His-tag) human recombinant protein, 0.25 mg
| Tag | His-tag |
| Expression Host | E. coli |
CSK (1-450, His-tag) human recombinant protein, 50 µg
| Tag | His-tag |
| Expression Host | E. coli |
CSK MS Standard C13 and N15-labeled recombinant protein (NP_004374)
| Tag | C-Myc/DDK |
| Expression Host | HEK293 |
CSK MS Standard C13 and N15-labeled recombinant protein (NP_001120662)
| Tag | C-Myc/DDK |
| Expression Host | HEK293 |
CSK (untagged)-Human c-src tyrosine kinase (CSK), transcript variant 2
| Vector | pCMV6-Entry |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
Transient overexpression of CSK (NM_004383) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of CSK (NM_001127190) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of CSK (NM_004383) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of CSK (NM_004383) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Transient overexpression of CSK (NM_001127190) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of CSK (NM_001127190) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Active filters
Target Symbol
- CSK
Families
- Protein Kinase