Products

cDNA Clones (20)
Proteins (12)
Antibodies (4)
Jump to Filters
View as table Download
DAP Kinase 1 (DAPK1) (NM_004938) Human Tagged ORF Clone
RG215423

USD 660.00

In Stock

DAPK1 (GFP-tagged) - Human death-associated protein kinase 1 (DAPK1)

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
DAP Kinase 1 (DAPK1) Rabbit Polyclonal Antibody
TA324907

USD 450.00

2 Weeks

Rabbit polyclonal DAPK1 Antibody (C-term)

Applications IF, IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen This DAPK1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 1360-1389 amino acids from the C-terminal region of human DAPK1.
DAP Kinase 1 (DAPK1) (NM_001288729) Human Tagged ORF Clone
RC240139

USD 600.00

5 Weeks

DAPK1 (myc-DDK-tagged) - Human death-associated protein kinase 1 (DAPK1), transcript variant 2

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
DAP Kinase 1 (DAPK1) (NM_001288730) Human Tagged ORF Clone
RC240140

USD 600.00

5 Weeks

DAPK1 (myc-DDK-tagged) - Human death-associated protein kinase 1 (DAPK1), transcript variant 3

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
DAP Kinase 1 (DAPK1) (NM_001288731) Human Tagged ORF Clone
RC240141

USD 600.00

5 Weeks

DAPK1 (myc-DDK-tagged) - Human death-associated protein kinase 1 (DAPK1), transcript variant 4

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
DAP Kinase 1 (DAPK1) (NM_004938) Human Untagged Clone
SC125504

USD 1,100.00

In Stock

DAPK1 (untagged)-Human death-associated protein kinase 1 (DAPK1)

Vector pCMV6-XL4
Tag Tag Free
Mammalian Cell Selection None
DAP Kinase 1 (DAPK1) Rabbit Polyclonal Antibody
TA344411

USD 475.00

Backordered

Rabbit Polyclonal Anti-DAPK1 Antibody - N-terminal region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-DAPK1 antibody: synthetic peptide directed towards the N terminal of human DAPK1. Synthetic peptide located within the following region: MTVFRQENVDDYYDTGEELGSGQFAVVKKCREKSTGLQYAAKFIKKRRTK
DAP Kinase 1 (DAPK1) (NM_004938) Human Over-expression Lysate
LC417640

USD 187.00

In Stock

DAPK1 HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
DAP Kinase 1 (DAPK1) (NM_004938) Human Over-expression Lysate
LY417640

USD 605.00

In Stock

Transient overexpression lysate of death-associated protein kinase 1 (DAPK1)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
DAP Kinase 1 (DAPK1) Rabbit Polyclonal Antibody
TA332877

USD 275.00

3 Weeks

Rabbit anti-DAPK1 Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human DAPK1
DAP Kinase 1 (DAPK1) (NM_004938) Human Untagged Clone
SC323458

USD 1,100.00

In Stock

DAPK1 (untagged)-Kinase deficient mutant (K42M) of Human death-associated protein kinase 1 (DAPK1)

Vector pCMV6-XL5
Tag Tag Free
Mammalian Cell Selection None
DAP Kinase 1 (DAPK1) Rabbit Polyclonal Antibody
TA590614

USD 409.00

In Stock

Rabbit Polyclonal DAP Kinase 1 Antibody

Applications ELISA
Reactivities Human
Conjugation Unconjugated
Immunogen DNA immunization. This antibody is specific for the C Terminus Region of the target protein.
DAP Kinase 1 (DAPK1) (NM_004938) Human Mass Spec Standard
PH315423

USD 2,055.00

3 Weeks

DAPK1 MS Standard C13 and N15-labeled recombinant protein (NP_004929)

Tag C-Myc/DDK
Expression Host HEK293
DAP Kinase 1 (DAPK1) (NM_001288729) Human Tagged ORF Clone
RG240139

USD 640.00

2 Weeks

DAPK1 (GFP-tagged) - Human death-associated protein kinase 1 (DAPK1), transcript variant 2

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
DAP Kinase 1 (DAPK1) (NM_001288730) Human Tagged ORF Clone
RG240140

USD 640.00

2 Weeks

DAPK1 (GFP-tagged) - Human death-associated protein kinase 1 (DAPK1), transcript variant 3

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
DAP Kinase 1 (DAPK1) (NM_001288731) Human Tagged ORF Clone
RG240141

USD 640.00

2 Weeks

DAPK1 (GFP-tagged) - Human death-associated protein kinase 1 (DAPK1), transcript variant 4

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
DAP Kinase 1 (DAPK1) (NM_001288729) Human Untagged Clone
SC338033

USD 1,450.00

5 Weeks

DAPK1 (untagged) - Human death-associated protein kinase 1 (DAPK1), transcript variant 2

Vector pCMV6 series
Tag Tag Free
DAP Kinase 1 (DAPK1) (NM_001288730) Human Untagged Clone
SC338034

USD 1,450.00

5 Weeks

DAPK1 (untagged) - Human death-associated protein kinase 1 (DAPK1), transcript variant 3

Vector pCMV6 series
Tag Tag Free
DAP Kinase 1 (DAPK1) (NM_001288731) Human Untagged Clone
SC338035

USD 1,450.00

5 Weeks

DAPK1 (untagged) - Human death-associated protein kinase 1 (DAPK1), transcript variant 4

Vector pCMV6 series
Tag Tag Free
DAP Kinase 1 (DAPK1) ICC Control Block
TB415423

USD 1,250.00

4 Weeks

Transient overexpression of DAPK1 (NM_004938) in HEK293T cells paraffin embedded controls for ICC/IHC staining

DAP Kinase 1 (DAPK1) ICC Control Block
TB440139

USD 1,250.00

4 Weeks

Transient overexpression of DAPK1 (NM_001288729) in HEK293T cells paraffin embedded controls for ICC/IHC staining

DAP Kinase 1 (DAPK1) ICC Control Block
TB440140

USD 1,250.00

4 Weeks

Transient overexpression of DAPK1 (NM_001288730) in HEK293T cells paraffin embedded controls for ICC/IHC staining

DAP Kinase 1 (DAPK1) ICC Control Block
TB440141

USD 1,250.00

4 Weeks

Transient overexpression of DAPK1 (NM_001288731) in HEK293T cells paraffin embedded controls for ICC/IHC staining

DAP Kinase 1 (DAPK1) Cytosection
TS415423

USD 225.00

4 Weeks

Transient overexpression of DAPK1 (NM_004938) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

DAP Kinase 1 (DAPK1) Cytosection
TS415423P5

USD 889.00

4 Weeks

Transient overexpression of DAPK1 (NM_004938) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack

DAP Kinase 1 (DAPK1) ICC Control Sections
TS440139P5

USD 889.00

4 Weeks

Transient overexpression of DAPK1 (NM_001288729) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack

DAP Kinase 1 (DAPK1) ICC Control Sections
TS440140P5

USD 889.00

4 Weeks

Transient overexpression of DAPK1 (NM_001288730) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack

DAP Kinase 1 (DAPK1) ICC Control Sections
TS440141P5

USD 889.00

4 Weeks

Transient overexpression of DAPK1 (NM_001288731) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack