Products

cDNA Clones (19)
Proteins (13)
Antibodies (7)
Jump to Filters
View as table Download
Eph receptor A3 (EPHA3) (NM_005233) Human Tagged ORF Clone
RG209191

USD 830.00

In Stock

EPHA3 (GFP-tagged) - Human EPH receptor A3 (EPHA3), transcript variant 1

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
Eph receptor A3 (EPHA3) (NM_005233) Human Recombinant Protein
TP309191

USD 439.00

4 Weeks

Recombinant protein of human EPH receptor A3 (EPHA3), transcript variant 1

Tag C-Myc/DDK
Expression Host HEK293T
Eph receptor A3 (EPHA3) (NM_182644) Human Tagged ORF Clone
RG220326

USD 530.00

In Stock

EPHA3 (GFP-tagged) - Human EPH receptor A3 (EPHA3), transcript variant 2

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
Eph receptor A3 (EPHA3) (NM_182644) Human Tagged ORF Clone
RC220326

USD 480.00

In Stock

EPHA3 (Myc-DDK-tagged)-Human EPH receptor A3 (EPHA3), transcript variant 2

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
Eph receptor A3 (EPHA3) (NM_005233) Human Tagged ORF Clone
RC600039

USD 650.00

In Stock

EPHA3 (DDK-His-tagged)-Extra Cellular Domain Clone of Homo sapiens EPH receptor A3, transcript variant 1, Signal peptide (1-20) plus EC domain (21-541)

Vector pCMV6-XL5-DDK-His
Tag DDK-His
Mammalian Cell Selection None
  • TrueORF®
Eph receptor A3 (EPHA3) (NM_182644) Human Tagged ORF Clone
RC600040

USD 650.00

In Stock

EPHA3 (DDK-His-tagged)-Extra Cellular Domain Clone of Homo sapiens EPH receptor A3, transcript variant 2, Signal peptide (1-20) plus EC domain (21-539)

Vector pCMV6-XL5-DDK-His
Tag DDK-His
Mammalian Cell Selection None
  • TrueORF®
Eph receptor A3 (EPHA3) (NM_005233) Human Tagged ORF Clone Lentiviral Particle
RC209191L3V

USD 1,150.00

7 Weeks

Lenti ORF particles, EPHA3 (Myc-DDK tagged) - Human EPH receptor A3 (EPHA3), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Eph receptor A3 (EPHA3) (NM_182644) Human Tagged ORF Clone Lentiviral Particle
RC220326L3V

USD 880.00

6 Weeks

Lenti ORF particles, EPHA3 (Myc-DDK-tagged)-Human EPH receptor A3 (EPHA3), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Eph receptor A3 (EPHA3) (NM_005233) Human Untagged Clone
SC109197

USD 540.00

In Stock

EPHA3 (untagged)-Human EPH receptor A3 (EPHA3), transcript variant 1

Vector pCMV6-XL4
Tag Tag Free
Mammalian Cell Selection None
Eph receptor A3 (EPHA3) Rabbit Polyclonal Antibody
TA312906

USD 345.00

In Stock

Rabbit polyclonal EPHA3 (Ab-602) antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from Internal of human EPHA3.
Eph receptor A3 (EPHA3) Rabbit Polyclonal Antibody
TA347940

USD 380.00

4 Weeks

Rabbit Polyclonal Anti-EPHA3 Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-EPHA3 Antibody: A synthesized peptide derived from human EPHA3
Eph receptor A3 (EPHA3) Rabbit Polyclonal Antibody
TA312904

USD 345.00

In Stock

Rabbit polyclonal anti-EPHA3 antibody

Applications WB
Reactivities Human Mouse Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human EPHA3.
Eph receptor A3 (EPHA3) Rabbit Polyclonal Antibody
TA344263

USD 475.00

5 Days

Rabbit Polyclonal Anti-EPHA3 Antibody - N-terminal region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-EPHA3 antibody is: synthetic peptide directed towards the N-terminal region of Human EPHA3. Synthetic peptide located within the following region: SVLDSFGELIPQPSNEVNLLDSKTIQGELGWISYPSHGWEEISGVDEHYT
Eph receptor A3 (EPHA3) (NM_182644) Human Recombinant Protein
TP700140

USD 748.00

In Stock

Purified recombinant protein of human EPH receptor A3 (EPHA3), transcript variant 2, with C-terminal DDK/His tag, expressed in human cells, 20 µg

Tag C-DDK/His
Expression Host HEK293
Eph receptor A3 (EPHA3) (NM_005233) Human Untagged Clone
SC323494

USD 760.00

In Stock

EPHA3 (untagged)-Kinase deficient mutant (K653M) of Human EPH receptor A3 (EPHA3), transcript variant 1

Vector pCMV6-XL4
Tag Tag Free
Mammalian Cell Selection None
Eph receptor A3 (EPHA3) Rabbit Polyclonal Antibody
TA312905

USD 345.00

In Stock

Rabbit polyclonal EPHA3/4/5 (Tyr779/833) antibody(Phospho-specific)

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized phosphopeptide derived from human EPHA3/4/5 around the phosphorylation site of tyrosine 779 (A-A-YP-T-T).
Modifications Phospho-specific
Eph receptor A3 (EPHA3) (NM_005233) Human Over-expression Lysate
LC417428

USD 121.00

In Stock

EPHA3 HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
Eph receptor A3 (EPHA3) (NM_005233) Human Recombinant Protein
TP710104

USD 425.00

In Stock

Recombinant protein of human EPH receptor A3 (EPHA3), transcript variant 1, residues 21-541aa, with C-terminal DDK tag, expressed in sf9, 20ug

Tag C-DDK
Expression Host Sf9
Eph receptor A3 (EPHA3) (NM_005233) Human Mass Spec Standard
PH309191

USD 2,055.00

3 Weeks

EPHA3 MS Standard C13 and N15-labeled recombinant protein (NP_005224)

Tag C-Myc/DDK
Expression Host HEK293
Eph receptor A3 (EPHA3) (NM_182644) Human Untagged Clone
SC313919

USD 910.00

3 Weeks

EPHA3 (untagged)-Human EPH receptor A3 (EPHA3), transcript variant 2

Vector pCMV6-Entry
Tag Tag Free
Mammalian Cell Selection Neomycin
Eph receptor A3 (EPHA3) Rabbit Polyclonal Antibody
TA890116

USD 345.00

In Stock

Rabbit Polyclonal anti-EPHA3 Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human EPHA3
Eph receptor A3 (EPHA3) Rabbit Polyclonal Antibody
TA890116S

USD 159.00

2 Days

Rabbit Polyclonal anti-EPHA3 Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human EPHA3
Eph receptor A3 (EPHA3) ICC Control Block
TB409191

USD 1,400.00

4 Weeks

Transient overexpression of EPHA3 (NM_005233) in HEK293T cells paraffin embedded controls for ICC/IHC staining

Eph receptor A3 (EPHA3) ICC Control Block
TB420326

USD 1,130.00

4 Weeks

Transient overexpression of EPHA3 (NM_182644) in HEK293T cells paraffin embedded controls for ICC/IHC staining

Eph receptor A3 (EPHA3) (NM_005233) Human Recombinant Protein
TP700139

USD 748.00

3 Weeks

Purified recombinant protein of human EPH receptor A3 (EPHA3), transcript variant 1, with C-terminal DDK/His tag, expressed in human cells, 20 µg

Tag C-DDK/His
Expression Host HEK293
Eph receptor A3 (EPHA3) Cytosection
TS409191

USD 225.00

4 Weeks

Transient overexpression of EPHA3 (NM_005233) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

Eph receptor A3 (EPHA3) Cytosection
TS409191P5

USD 889.00

4 Weeks

Transient overexpression of EPHA3 (NM_005233) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack

Eph receptor A3 (EPHA3) Cytosection
TS420326

USD 225.00

4 Weeks

Transient overexpression of EPHA3 (NM_182644) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

Eph receptor A3 (EPHA3) Cytosection
TS420326P5

USD 889.00

4 Weeks

Transient overexpression of EPHA3 (NM_182644) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack