Products

cDNA Clones (21)
Antibodies (15)
Proteins (6)
Jump to Filters
View as table Download
GRK1 (NM_002929) Human Tagged ORF Clone
RC214569

USD 420.00

In Stock

GRK1 (Myc-DDK-tagged)-Human G protein-coupled receptor kinase 1 (GRK1)

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
GRK1 (NM_002929) Human Tagged ORF Clone Lentiviral Particle
RC214569L1V

USD 820.00

3 Weeks

Lenti ORF particles, GRK1 (Myc-DDK tagged) - Human G protein-coupled receptor kinase 1 (GRK1), 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
  • LentiORF®
GRK1 (NM_002929) Human Tagged ORF Clone Lentiviral Particle
RC214569L2V

USD 820.00

6 Weeks

Lenti ORF particles, GRK1 (mGFP-tagged) - Human G protein-coupled receptor kinase 1 (GRK1), 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP
Tag mGFP
  • LentiORF®
GRK1 (NM_002929) Human Tagged ORF Clone
RG214569

USD 460.00

In Stock

GRK1 (GFP-tagged) - Human G protein-coupled receptor kinase 1 (GRK1)

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
GRK1 (NM_002929) Human Tagged ORF Clone
RC214569L3

USD 620.00

3 Weeks

Lenti ORF clone of Human G protein-coupled receptor kinase 1 (GRK1), Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
GRK1 (NM_002929) Human Tagged ORF Clone Lentiviral Particle
RC214569L3V

USD 820.00

5 Weeks

Lenti ORF particles, GRK1 (Myc-DDK tagged) - Human G protein-coupled receptor kinase 1 (GRK1), 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
GRK1 (NM_002929) Human Tagged ORF Clone
RC214569L4

USD 620.00

3 Weeks

Lenti ORF clone of Human G protein-coupled receptor kinase 1 (GRK1), mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
GRK1 (NM_002929) Human Tagged ORF Clone Lentiviral Particle
RC214569L4V

USD 820.00

7 Weeks

Lenti ORF particles, GRK1 (mGFP-tagged) - Human G protein-coupled receptor kinase 1 (GRK1), 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
GRK1 (NM_002929) Human Mutant ORF Clone
RC402677

USD 760.00

2 Weeks

GRK1 Mutant (P290L), Myc-DDK-tagged ORF clone of Homo sapiens G protein-coupled receptor kinase 1 (GRK1) as transfection-ready DNA

Mutation P290L
Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
GRK1 (NM_002929) Human Mutant ORF Clone
RC402678

USD 760.00

2 Weeks

GRK1 Mutant (T298M), Myc-DDK-tagged ORF clone of Homo sapiens G protein-coupled receptor kinase 1 (GRK1) as transfection-ready DNA

Mutation T298M
Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
GRK1 (NM_002929) Human Mutant ORF Clone
RC402679

USD 760.00

2 Weeks

GRK1 Mutant (N330S), Myc-DDK-tagged ORF clone of Homo sapiens G protein-coupled receptor kinase 1 (GRK1) as transfection-ready DNA

Mutation N330S
Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
GRK1 (NM_002929) Human Mutant ORF Clone
RC402680

USD 760.00

2 Weeks

GRK1 Mutant (V380D), Myc-DDK-tagged ORF clone of Homo sapiens G protein-coupled receptor kinase 1 (GRK1) as transfection-ready DNA

Mutation V380D
Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
GRK1 (NM_002929) Human Mutant ORF Clone
RC402681

USD 760.00

2 Weeks

GRK1 Mutant (P391H), Myc-DDK-tagged ORF clone of Homo sapiens G protein-coupled receptor kinase 1 (GRK1) as transfection-ready DNA

Mutation P391H
Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
GRK1 (NM_002929) Human Mutant ORF Clone
RC402682

USD 760.00

2 Weeks

GRK1 Mutant (R438H), Myc-DDK-tagged ORF clone of Homo sapiens G protein-coupled receptor kinase 1 (GRK1) as transfection-ready DNA

Mutation R438H
Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
GRK1 (NM_002929) Human Mutant ORF Clone
RC402683

USD 760.00

2 Weeks

GRK1 Mutant (W460R), Myc-DDK-tagged ORF clone of Homo sapiens G protein-coupled receptor kinase 1 (GRK1) as transfection-ready DNA

Mutation W460R
Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
GRK1 (NM_002929) Human Mutant ORF Clone
RC402684

USD 760.00

2 Weeks

GRK1 Mutant (C514S), Myc-DDK-tagged ORF clone of Homo sapiens G protein-coupled receptor kinase 1 (GRK1) as transfection-ready DNA

Mutation C514S
Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
GRK1 (NM_002929) Human Mutant ORF Clone
RC402685

USD 760.00

2 Weeks

GRK1 Mutant (M522T), Myc-DDK-tagged ORF clone of Homo sapiens G protein-coupled receptor kinase 1 (GRK1) as transfection-ready DNA

Mutation M522T
Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
GRK1 (NM_002929) Human Mutant ORF Clone
RC402686

USD 760.00

2 Weeks

GRK1 Mutant (S536L), Myc-DDK-tagged ORF clone of Homo sapiens G protein-coupled receptor kinase 1 (GRK1) as transfection-ready DNA

Mutation S536L
Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
GRK1 (NM_002929) Human Tagged Lenti ORF Clone
RC214569L1

USD 768.00

In Stock

Lenti ORF clone of Human G protein-coupled receptor kinase 1 (GRK1), Myc-DDK-tagged

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
Mammalian Cell Selection None
  • LentiORF®
GRK1 Rabbit Polyclonal Antibody
TA327459

USD 275.00

2 Weeks

GRK1 Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen A synthetic peptide of human GRK1
GRK1 (NM_002929) Human Untagged Clone
SC128096

USD 760.00

In Stock

GRK1 (untagged)-Human G protein-coupled receptor kinase 1 (GRK1)

Vector pCMV6-XL5
Tag Tag Free
Mammalian Cell Selection None
GRK1 Rabbit Polyclonal Antibody
TA314446

USD 345.00

In Stock

Rabbit polyclonal GRK1 (Ab-21) antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized non-phosphopeptide derived from human GRK1 around the phosphorylation site of serine 21 (R-G-SP-F-D)
GRK1 (NM_002929) Human Tagged ORF Clone
RC214569L2

USD 620.00

3 Weeks

Lenti ORF clone of Human G protein-coupled receptor kinase 1 (GRK1), mGFP tagged

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®
GRK1 Rabbit Polyclonal Antibody
AP01451PU-N

USD 370.00

2 Weeks

GRK1 rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human, Mouse, Rat
GRK1 (NM_002929) Human Over-expression Lysate
LC419010

USD 187.00

In Stock

GRK1 HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
GRK1 (NM_002929) Human Over-expression Lysate
LY419010

USD 605.00

5 Days

Transient overexpression lysate of G protein-coupled receptor kinase 1 (GRK1)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
GRK1 Rabbit Polyclonal Antibody
TA342734

USD 375.00

5 Days

Rabbit Polyclonal Anti-GRK1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-GRK1 antibody: synthetic peptide directed towards the middle region of human GRK1. Synthetic peptide located within the following region: NKELKHRIISEPVKYPDKFSQASKDFCEALLEKDPEKRLGFRDETCDKLR
GRK1 Mouse Monoclonal Antibody [Clone ID: OTI1E11]
CF811854

USD 465.00

4 Weeks

Carrier-free (BSA/glycerol-free) GRK1 mouse monoclonal antibody,clone OTI1E11

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
GRK1 Mouse Monoclonal Antibody [Clone ID: OTI4G8]
CF811857

USD 465.00

4 Weeks

Carrier-free (BSA/glycerol-free) GRK1 mouse monoclonal antibody,clone OTI4G8

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
GRK1 (NM_002929) Human Mass Spec Standard
PH314569

USD 2,055.00

3 Weeks

GRK1 MS Standard C13 and N15-labeled recombinant protein (NP_002920)

Tag C-Myc/DDK
Expression Host HEK293
GRK1 Rabbit Polyclonal Antibody
TA322932

USD 345.00

In Stock

Anti-GRK1 Rabbit Polyclonal Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 21-35 amino acids of Human G protein-coupled receptor kinase 1
GRK1 Mouse Monoclonal Antibody [Clone ID: OTI1E11]
TA811854

USD 379.00

In Stock

GRK1 mouse monoclonal antibody,clone OTI1E11

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
GRK1 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI1E11]
TA811854AM

USD 420.00

4 Weeks

GRK1 mouse monoclonal antibody,clone OTI1E11, Biotinylated

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Biotin
GRK1 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI1E11]
TA811854BM

USD 420.00

4 Weeks

GRK1 mouse monoclonal antibody,clone OTI1E11, HRP conjugated

Applications WB
Reactivities Human, Mouse, Rat
Conjugation HRP
GRK1 Mouse Monoclonal Antibody [Clone ID: OTI1E11]
TA811854S

USD 159.00

2 Days

GRK1 mouse monoclonal antibody,clone OTI1E11

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
GRK1 Mouse Monoclonal Antibody [Clone ID: OTI4G8]
TA811857

USD 379.00

In Stock

GRK1 mouse monoclonal antibody,clone OTI4G8

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
GRK1 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI4G8]
TA811857AM

USD 420.00

4 Weeks

GRK1 mouse monoclonal antibody,clone OTI4G8, Biotinylated

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Biotin
GRK1 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI4G8]
TA811857BM

USD 420.00

4 Weeks

GRK1 mouse monoclonal antibody,clone OTI4G8, HRP conjugated

Applications WB
Reactivities Human, Mouse, Rat
Conjugation HRP
GRK1 Mouse Monoclonal Antibody [Clone ID: OTI4G8]
TA811857S

USD 159.00

2 Days

GRK1 mouse monoclonal antibody,clone OTI4G8

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
GRK1 (NM_002929) ICC Control Block
TB414569

USD 1,070.00

4 Weeks

Transient overexpression of GRK1 (NM_002929) in HEK293T cells paraffin embedded controls for ICC/IHC staining

GRK1 Cytosection
TS414569

USD 225.00

4 Weeks

Transient overexpression of GRK1 (NM_002929) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

GRK1 Cytosection
TS414569P5

USD 889.00

4 Weeks

Transient overexpression of GRK1 (NM_002929) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack