Germany
Japan
United Kingdom
China
SGK3 (Myc-DDK-tagged)-Human serum/glucocorticoid regulated kinase family, member 3 (SGK3), transcript variant 1
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
Products
View as table Download
SGK3 (Myc-DDK-tagged)-Human serum/glucocorticoid regulated kinase family, member 3 (SGK3), transcript variant 2
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
SGK3 (Myc-DDK-tagged)-Human serum/glucocorticoid regulated kinase family, member 3 (SGK3), transcript variant 3
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
Lenti ORF particles, SGK3 (Myc-DDK tagged) - Human serum/glucocorticoid regulated kinase family, member 3 (SGK3), transcript variant 1, 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
- LentiORF®
-
Lenti ORF particles, SGK3 (mGFP-tagged) - Human serum/glucocorticoid regulated kinase family, member 3 (SGK3), transcript variant 1, 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
- LentiORF®
-
Lenti ORF particles, SGK3 (Myc-DDK tagged) - Human serum/glucocorticoid regulated kinase family, member 3 (SGK3), transcript variant 3, 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
- LentiORF®
-
Lenti ORF particles, SGK3 (mGFP-tagged) - Human serum/glucocorticoid regulated kinase family, member 3 (SGK3), transcript variant 3, 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
- LentiORF®
-
SGK3 (GFP-tagged) - Human serum/glucocorticoid regulated kinase family, member 3 (SGK3), transcript variant 3
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Recombinant protein of human serum/glucocorticoid regulated kinase family, member 3 (SGK3), transcript variant 1
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
SGK3 (GFP-tagged) - Human serum/glucocorticoid regulated kinase family, member 3 (SGK3), transcript variant 2
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
SGK3 (GFP-tagged) - Human serum/glucocorticoid regulated kinase family, member 3 (SGK3), transcript variant 1
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti ORF clone of Human serum/glucocorticoid regulated kinase family, member 3 (SGK3), transcript variant 1, Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, SGK3 (Myc-DDK tagged) - Human serum/glucocorticoid regulated kinase family, member 3 (SGK3), transcript variant 1, 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human serum/glucocorticoid regulated kinase family, member 3 (SGK3), transcript variant 1, mGFP tagged
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, SGK3 (mGFP-tagged) - Human serum/glucocorticoid regulated kinase family, member 3 (SGK3), transcript variant 1, 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human serum/glucocorticoid regulated kinase family, member 3 (SGK3), transcript variant 2, Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, SGK3 (Myc-DDK tagged) - Human serum/glucocorticoid regulated kinase family, member 3 (SGK3), transcript variant 2, 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human serum/glucocorticoid regulated kinase family, member 3 (SGK3), transcript variant 2, mGFP tagged
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, SGK3 (mGFP-tagged) - Human serum/glucocorticoid regulated kinase family, member 3 (SGK3), transcript variant 2, 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human serum/glucocorticoid regulated kinase family, member 3 (SGK3), transcript variant 3, Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, SGK3 (Myc-DDK tagged) - Human serum/glucocorticoid regulated kinase family, member 3 (SGK3), transcript variant 3, 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human serum/glucocorticoid regulated kinase family, member 3 (SGK3), transcript variant 3, mGFP tagged
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, SGK3 (mGFP-tagged) - Human serum/glucocorticoid regulated kinase family, member 3 (SGK3), transcript variant 3, 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human serum/glucocorticoid regulated kinase family, member 3 (SGK3), transcript variant 1, Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
| Mammalian Cell Selection | None |
- LentiORF®
Lenti ORF clone of Human serum/glucocorticoid regulated kinase family, member 3 (SGK3), transcript variant 3, Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
| Mammalian Cell Selection | None |
- LentiORF®
SGK3 (untagged)-Human serum/glucocorticoid regulated kinase family, member 3 (SGK3), transcript variant 1
| Vector | pCMV6-XL5 |
| Tag | Tag Free |
| Mammalian Cell Selection | None |
Transient overexpression lysate of serum/glucocorticoid regulated kinase family, member 3 (SGK3), transcript variant 1
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Special Offer: Get a 20% discount on this product. Use code: "OEL20".
SGK3 (untagged)-Kinase deficient mutant (K191M) of Human serum/glucocorticoid regulated kinase family, member 3 (SGK3), transcript variant 1
| Vector | pCMV6-XL5 |
| Tag | Tag Free |
| Mammalian Cell Selection | None |
SGK3 (untagged)-Human serum/glucocorticoid regulated kinase family, member 3 (SGK3), transcript variant 1
| Vector | pCMV6-AC |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
Lenti ORF clone of Human serum/glucocorticoid regulated kinase family, member 3 (SGK3), transcript variant 1, mGFP tagged
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
| Mammalian Cell Selection | None |
- LentiORF®
Lenti ORF clone of Human serum/glucocorticoid regulated kinase family, member 3 (SGK3), transcript variant 3, mGFP tagged
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
| Mammalian Cell Selection | None |
- LentiORF®
SGK3 (untagged)-Human serum/glucocorticoid regulated kinase family, member 3 (SGK3), transcript variant 2
| Vector | pCMV6-XL4 |
| Tag | Tag Free |
| Mammalian Cell Selection | None |
Recombinant protein of human serum/glucocorticoid regulated kinase family, member 3 (SGK3), transcript variant 3, full length, with N-terminal HIS tag, expressed in E.Coli, 50ug
| Tag | N-His |
| Expression Host | E. coli |
SGK3 HEK293T cell transient overexpression lysate (as WB positive control)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Transient overexpression lysate of serum/glucocorticoid regulated kinase family, member 3 (SGK3), transcript variant 2
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Special Offer: Get a 20% discount on this product. Use code: "OEL20".
SGK3 Rabbit Polyclonal (Internal) Antibody
| Applications | IHC |
| Reactivities | Bat, Gibbon, Dog, Gorilla, Hamster, Human, Mouse, Orang-Utan, Rat |
| Immunogen | SGK3 antibody was raised against synthetic 20 amino acid peptide from internal region of human SGK3. Percent identity with other species by BLAST analysis: Human, Gorilla, Orangutan, Gibbon, Mouse, Rat, Hamster, Panda, Dog, Bat (100%); Monkey, Marmoset, Elephant, Bovine, Horse, Rabbit (95%); Turkey, Chicken, Platypus (90%); Opossum, Lizard (85%). |
Rabbit polyclonal Anti-SGK3 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Immunogen | The immunogen for anti-SGK3 antibody: synthetic peptide directed towards the N terminal of human SGK3. Synthetic peptide located within the following region: LYNHPDVRAFLQMDSPKHQSDPSEDEDERSSQKLHSTSQNINLGPSGNPH |
Rabbit Polyclonal Anti-SGK3 Antibody (C-Terminus)
| Applications | IHC |
| Reactivities | Human |
| Immunogen | SGK3 antibody was raised against synthetic 17 amino acid peptide from C-terminus of human SGK3. Percent identity with other species by BLAST analysis: Human, Gorilla, Orangutan, Gibbon, Monkey, Marmoset, Rabbit (100%); Dog, Bat, Elephant, Panda, Horse (94%); Mouse, Rat, Hamster, Pig, Lizard (88%); Bovine, Opossum (82%). |
SGK3 HEK293T cell transient overexpression lysate (as WB positive control)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
SGK3 HEK293T cell transient overexpression lysate (as WB positive control)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Transient overexpression lysate of serum/glucocorticoid regulated kinase family, member 3 (SGK3), transcript variant 3
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Special Offer: Get a 20% discount on this product. Use code: "OEL20".
SGK3 MS Standard C13 and N15-labeled recombinant protein (NP_037389)
| Tag | C-Myc/DDK |
| Expression Host | HEK293 |
SGK3 (untagged)-Human serum/glucocorticoid regulated kinase family, member 3 (SGK3), transcript variant 3
| Vector | pCMV6-Entry |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
Transient overexpression of SGK3 (NM_013257) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of SGK3 (NM_170709) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of SGK3 (NM_001033578) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of SGK3 (NM_013257) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of SGK3 (NM_013257) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Transient overexpression of SGK3 (NM_170709) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Active filters
Target Symbol
- SGK3
Families
- Protein Kinase