Germany
Japan
United Kingdom
China
CXCL12 (untagged)-Human chemokine (C-X-C motif) ligand 12 (CXCL12), transcript variant 3
| Vector | pCMV6-XL6 |
| Tag | Tag Free |
| Mammalian Cell Selection | None |
Products
View as table Download
SDF1 (CXCL12) (beta) goat polyclonal antibody, Biotin
| Applications | ELISA, WB |
| Reactivities | Human |
| Conjugation | Biotin |
| Immunogen | Highly pure (>98%) E.coli derived recombinant Human SDF1-beta. |
SDF1 (CXCL12) (beta) goat polyclonal antibody, Biotin
| Applications | ELISA, WB |
| Reactivities | Human |
| Conjugation | Biotin |
| Immunogen | Highly pure (>98%) E.coli derived recombinant Human SDF1-beta. |
Rabbit polyclonal anti-SDF-1beta antibody
| Applications | WB |
| Reactivities | Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | E. coli-expressed mouse SDF-1β |
Anti-Human SDF-1a Rabbit Polyclonal Antibody
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | E.coli derived Recombinant Human SDF-1α (CXCL12) |
Rabbit Polyclonal Anti-CXCL12 Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CXCL12 antibody: synthetic peptide directed towards the middle region of human CXCL12. Synthetic peptide located within the following region: VKHLKILNTPNCALQIVARLKNNNRQVCIDPKLKWIQEYLEKALNKRFKM |
CXCL12 / SDF1 (22-93, His-tag) human recombinant protein, 0.25 mg
| Tag | His-tag |
| Expression Host | E. coli |
CXCL12 / SDF1 (22-93, His-tag) human recombinant protein, 50 µg
| Tag | His-tag |
| Expression Host | E. coli |
CXCL12 HEK293T cell transient overexpression lysate (as WB positive control)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
CXCL12 MS Standard C13 and N15-labeled recombinant protein (NP_954637)
| Tag | C-Myc/DDK |
| Expression Host | HEK293 |
CXCL12 (GFP-tagged) - Human chemokine (C-X-C motif) ligand 12 (CXCL12), transcript variant 5
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
CXCL12 (untagged) - Human chemokine (C-X-C motif) ligand 12 (CXCL12), transcript variant 5
| Vector | pCMV6-Entry |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
Anti-CXCL12 Rabbit Polyclonal Antibody
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region derived from 36-50 amino acids of human chemokine (C-X-C motif) ligand 12 |
Transient overexpression of CXCL12 (NM_199168) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of CXCL12 (NM_000609) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of CXCL12 (NM_001033886) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of CXCL12 (NM_001178134) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of CXCL12 (NM_001277990) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Recombinant protein of human chemokine (C-X-C motif) ligand 12 (stromal cell-derived factor 1) (CXCL12), transcript variant 2
| Tag | tag free |
| Expression Host | E. coli |
Recombinant protein of human chemokine (C-X-C motif) ligand 12 (stromal cell-derived factor 1) (CXCL12), transcript variant 2
| Tag | tag free |
| Expression Host | E. coli |
Recombinant protein of human chemokine (C-X-C motif) ligand 12 (stromal cell-derived factor 1) (CXCL12), transcript variant 2
| Tag | tag free |
| Expression Host | E. coli |
Recombinant protein of human chemokine (C-X-C motif) ligand 12 (stromal cell-derived factor 1) (CXCL12), transcript variant 2
| Tag | tag free |
| Expression Host | E. coli |
Recombinant protein of human chemokine (C-X-C motif) ligand 12 (stromal cell-derived factor 1) (CXCL12), transcript variant 2
| Tag | tag free |
| Expression Host | E. coli |
Recombinant protein of human chemokine (C-X-C motif) ligand 12 (stromal cell-derived factor 1) (CXCL12), transcript variant 2
| Tag | tag free |
| Expression Host | E. coli |
Recombinant protein of human chemokine (C-X-C motif) ligand 12 (stromal cell-derived factor 1) (CXCL12), transcript variant 2
| Tag | tag free |
| Expression Host | E. coli |
Recombinant protein of human chemokine (C-X-C motif) ligand 12 (stromal cell-derived factor 1) (CXCL12), transcript variant 2
| Tag | tag free |
| Expression Host | E. coli |
Recombinant protein of human chemokine (C-X-C motif) ligand 12 (stromal cell-derived factor 1) (CXCL12), transcript variant 2
| Tag | tag free |
| Expression Host | E. coli |
Recombinant protein of human chemokine (C-X-C motif) ligand 12 (stromal cell-derived factor 1) (CXCL12), transcript variant 2
| Tag | tag free |
| Expression Host | E. coli |
Recombinant protein of human chemokine (C-X-C motif) ligand 12 (stromal cell-derived factor 1) (CXCL12), transcript variant 2
| Tag | tag free |
| Expression Host | E. coli |
Transient overexpression of CXCL12 (NM_199168) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of CXCL12 (NM_199168) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Transient overexpression of CXCL12 (NM_000609) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of CXCL12 (NM_000609) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Transient overexpression of CXCL12 (NM_001033886) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Transient overexpression of CXCL12 (NM_001178134) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Transient overexpression of CXCL12 (NM_001277990) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Active filters
Target Symbol
- CXCL12
Families
- Secreted Protein