Products

View as table Download

Rabbit Polyclonal Anti-NT3

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Peptide GEIKTGNSPV(C), corresponding to amino acid residues 39-48 of mature human NT-3 (residues 177-186 of the NT-3 precursor).

Rabbit Polyclonal Anti-proNT-3

Applications IHC, WB
Reactivities Mouse, Rat
Conjugation Unconjugated
Immunogen Peptide (C)DTELLRQQRRYNSPR, corresponding to amino acid residues 89-103 of human NT-3 (precursor).Pro domain of the NT-3 protein.

Rabbit polyclonal Anti-Ntf3 Antibody

Applications WB
Reactivities Rat
Conjugation Unconjugated
Immunogen The immunogen for Anti-Ntf3 antibody is: synthetic peptide directed towards the N-terminal region of Ntf3. Synthetic peptide located within the following region: LAYLRGIQGNNMDQRSLPEDSLNSLIIKLIQADILKNKLSKQMVDVKENY

Carrier-free (BSA/glycerol-free) NT3 mouse monoclonal antibody, clone OTI5A2 (formerly 5A2)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) NT3 mouse monoclonal antibody, clone OTI2D1 (formerly 2D1)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) NT3 mouse monoclonal antibody, clone OTI3D4 (formerly 3D4)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Anti-NT3 (Neurotrophin 3) mouse monoclonal antibody, clone OTI5A2 (formerly 5A2)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Anti-NT3 (Neurotrophin 3) mouse monoclonal antibody, clone OTI5A2 (formerly 5A2), Biotinylated

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Biotin

Anti-NT3 (Neurotrophin 3) mouse monoclonal antibody, clone OTI5A2 (formerly 5A2), HRP conjugated

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation HRP

Anti-NT3 (Neurotrophin 3) mouse monoclonal antibody, clone OTI5A2 (formerly 5A2)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Anti-NT3 (Neurotrophin 3) mouse monoclonal antibody, clone OTI2D1 (formerly 2D1)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Anti-NT3 (Neurotrophin 3) mouse monoclonal antibody, clone OTI2D1 (formerly 2D1)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

NT3 (Neurotrophin 3) mouse monoclonal antibody, clone OTI3D4 (formerly 3D4)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

NT3 (Neurotrophin 3) mouse monoclonal antibody, clone OTI3D4 (formerly 3D4), Biotinylated

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Biotin

NT3 (Neurotrophin 3) mouse monoclonal antibody, clone OTI3D4 (formerly 3D4), HRP conjugated

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation HRP

NT3 (Neurotrophin 3) mouse monoclonal antibody, clone OTI3D4 (formerly 3D4)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Anti-NT3 (Neurotrophin 3) mouse monoclonal antibody, clone OTI5C7 (formerly 5C7)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Anti-NT3 (Neurotrophin 3) mouse monoclonal antibody, clone OTI5C7 (formerly 5C7), Biotinylated

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Biotin

Anti-NT3 (Neurotrophin 3) mouse monoclonal antibody, clone OTI5C7 (formerly 5C7), HRP conjugated

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation HRP

Anti-NT3 (Neurotrophin 3) mouse monoclonal antibody, clone OTI5C7 (formerly 5C7)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated