Products

Proteins (15)
cDNA Clones (14)
Antibodies (4)
Jump to Filters
View as table Download
GnRH (GNRH1) (NM_000825) Human Tagged ORF Clone
RC212991

USD 98.00

USD 390.00

In Stock

GNRH1 (Myc-DDK-tagged)-Human gonadotropin-releasing hormone 1 (luteinizing-releasing hormone) (GNRH1), transcript variant 1

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
GnRH (GNRH1) (NM_001083111) Human Tagged ORF Clone
RC219734

USD 420.00

In Stock

GNRH1 (Myc-DDK-tagged)-Human gonadotropin-releasing hormone 1 (luteinizing-releasing hormone) (GNRH1), transcript variant 2

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
GnRH (GNRH1) (NM_000825) Human Tagged ORF Clone
RG212991

USD 460.00

In Stock

GNRH1 (GFP-tagged) - Human gonadotropin-releasing hormone 1 (luteinizing-releasing hormone) (GNRH1), transcript variant 1

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
GnRH (GNRH1) (NM_000825) Human Tagged ORF Clone
RC212991L3

USD 620.00

3 Weeks

Lenti ORF clone of Human gonadotropin-releasing hormone 1 (luteinizing-releasing hormone) (GNRH1), transcript variant 1, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
GnRH (GNRH1) (NM_000825) Human Tagged ORF Clone Lentiviral Particle
RC212991L3V

USD 820.00

6 Weeks

Lenti ORF particles, GNRH1 (Myc-DDK tagged) - Human gonadotropin-releasing hormone 1 (luteinizing-releasing hormone) (GNRH1), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
GnRH (GNRH1) (NM_000825) Human Tagged ORF Clone
RC212991L4

USD 620.00

3 Weeks

Lenti ORF clone of Human gonadotropin-releasing hormone 1 (luteinizing-releasing hormone) (GNRH1), transcript variant 1, mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
GnRH (GNRH1) (NM_000825) Human Tagged ORF Clone Lentiviral Particle
RC212991L4V

USD 820.00

6 Weeks

Lenti ORF particles, GNRH1 (mGFP-tagged) - Human gonadotropin-releasing hormone 1 (luteinizing-releasing hormone) (GNRH1), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
GnRH (GNRH1) (NM_001083111) Human Tagged ORF Clone
RC219734L3

USD 620.00

3 Weeks

Lenti ORF clone of Human gonadotropin-releasing hormone 1 (luteinizing-releasing hormone) (GNRH1), transcript variant 2, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
GnRH (GNRH1) (NM_001083111) Human Tagged ORF Clone Lentiviral Particle
RC219734L3V

USD 820.00

6 Weeks

Lenti ORF particles, GNRH1 (Myc-DDK tagged) - Human gonadotropin-releasing hormone 1 (luteinizing-releasing hormone) (GNRH1), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
GnRH (GNRH1) (NM_001083111) Human Tagged ORF Clone
RC219734L4

USD 620.00

3 Weeks

Lenti ORF clone of Human gonadotropin-releasing hormone 1 (luteinizing-releasing hormone) (GNRH1), transcript variant 2, mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
GnRH (GNRH1) (NM_001083111) Human Tagged ORF Clone Lentiviral Particle
RC219734L4V

USD 820.00

6 Weeks

Lenti ORF particles, GNRH1 (mGFP-tagged) - Human gonadotropin-releasing hormone 1 (luteinizing-releasing hormone) (GNRH1), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
GnRH (GNRH1) (NM_001083111) Human Tagged ORF Clone
RG219734

USD 460.00

3 Weeks

GNRH1 (GFP-tagged) - Human gonadotropin-releasing hormone 1 (luteinizing-releasing hormone) (GNRH1), transcript variant 2

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
GnRH (GNRH1) Rabbit Polyclonal Antibody
TA349380

USD 380.00

4 Weeks

Rabbit Polyclonal Anti-GNRH1 Antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen Fusion protein of human GNRH1
GnRH (GNRH1) (NM_000825) Human Untagged Clone
SC300137

USD 420.00

In Stock

GNRH1 (untagged)-Human gonadotropin-releasing hormone 1 (luteinizing-releasing hormone) (GNRH1), transcript variant 1

Vector pCMV6-XL5
Tag Tag Free
Mammalian Cell Selection None
GnRH (GNRH1) Rabbit Polyclonal Antibody
20075

USD 360.00

3 Days

GnRH (GNRH1) rabbit polyclonal antibody

Applications IF, IHC
Reactivities Mammalian
Conjugation Unconjugated
GnRH (GNRH1) Rabbit Polyclonal Antibody
TA332797

USD 275.00

3 Weeks

Rabbit anti-GNRH1 Polyclonal Antibody

Applications ICC/IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human GNRH1
GNRH1 / Progonadoliberin-1 (24-92, His-tag) Human Protein
AR51532PU-N

USD 1,105.00

2 Weeks

GNRH1 / Progonadoliberin-1 (24-92, His-tag) human recombinant protein, 0.5 mg

Tag His-tag
Expression Host E. coli
GNRH1 / Progonadoliberin-1 (24-92, His-tag) Human Protein
AR51532PU-S

USD 415.00

2 Weeks

GNRH1 / Progonadoliberin-1 (24-92, His-tag) human recombinant protein, 0.1 mg

Tag His-tag
Expression Host E. coli
GnRH (GNRH1) (NM_001083111) Human Over-expression Lysate
LC421206

USD 121.00

2 Weeks

GNRH1 HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
GnRH (GNRH1) (NM_000825) Human Over-expression Lysate
LC424503

USD 121.00

2 Weeks

GNRH1 HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
GnRH (GNRH1) (NM_001083111) Human Over-expression Lysate
LC425953

USD 121.00

2 Weeks

GNRH1 HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
GnRH (GNRH1) (NM_001083111) Human Over-expression Lysate
LY421206

USD 396.00

5 Days

Transient overexpression lysate of gonadotropin-releasing hormone 1 (luteinizing-releasing hormone) (GNRH1), transcript variant 2

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
LY421206 is the same product as LY425953.
GnRH (GNRH1) (NM_000825) Human Over-expression Lysate
LY424503

USD 396.00

5 Days

Transient overexpression lysate of gonadotropin-releasing hormone 1 (luteinizing-releasing hormone) (GNRH1), transcript variant 1

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
GnRH (GNRH1) (NM_001083111) Human Over-expression Lysate
LY425953

USD 396.00

5 Days

Transient overexpression lysate of gonadotropin-releasing hormone 1 (luteinizing-releasing hormone) (GNRH1), transcript variant 2

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
GnRH (GNRH1) (NM_001083111) Human Mass Spec Standard
PH319734

USD 2,055.00

3 Weeks

GNRH1 MS Standard C13 and N15-labeled recombinant protein (NP_001076580)

Tag C-Myc/DDK
Expression Host HEK293
GnRH (GNRH1) (NM_001083111) Human Untagged Clone
SC315978

USD 420.00

3 Weeks

GNRH1 (untagged)-Human gonadotropin-releasing hormone 1 (luteinizing-releasing hormone) (GNRH1), transcript variant 2

Vector pCMV6-Entry
Tag Tag Free
Mammalian Cell Selection Neomycin
GnRH (GNRH1) Rabbit Polyclonal Antibody
TA358540

USD 360.00

5 Days

GNRH1 Antibody

Applications IHC
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the following sequence CSSQHWSYGLRPGGKRDAENLIDSFQEIVKEVGQLAETQRFECTTHQPRS
GnRH (GNRH1) (NM_000825) ICC Control Block
TB412991

USD 1,040.00

4 Weeks

Transient overexpression of GNRH1 (NM_000825) in HEK293T cells paraffin embedded controls for ICC/IHC staining

GnRH (GNRH1) (NM_001083111) ICC Control Block
TB419734

USD 1,070.00

4 Weeks

Transient overexpression of GNRH1 (NM_001083111) in HEK293T cells paraffin embedded controls for ICC/IHC staining

GnRH (GNRH1) Cytosection
TS412991

USD 225.00

4 Weeks

Transient overexpression of GNRH1 (NM_000825) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

GnRH (GNRH1) ICC Control Sections
TS412991P5

USD 889.00

4 Weeks

Transient overexpression of GNRH1 (NM_000825) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack

GnRH (GNRH1) Cytosection
TS419734

USD 225.00

4 Weeks

Transient overexpression of GNRH1 (NM_001083111) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

GnRH (GNRH1) Cytosection
TS419734P5

USD 889.00

4 Weeks

Transient overexpression of GNRH1 (NM_001083111) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack