Germany
Japan
United Kingdom
China
PDYN (Myc-DDK-tagged)-Human prodynorphin (PDYN), transcript variant 1
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
Products
View as table Download
USD 820.00
3 Weeks
Lenti ORF particles, PDYN (Myc-DDK tagged) - Human prodynorphin (PDYN), transcript variant 1, 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
- LentiORF®
-
USD 820.00
6 Weeks
Lenti ORF particles, PDYN (mGFP-tagged) - Human prodynorphin (PDYN), transcript variant 1, 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
- LentiORF®
-
PDYN (Myc-DDK tagged) - Homo sapiens prodynorphin (PDYN), transcript variant 3
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
PDYN (Myc-DDK tagged) - Homo sapiens prodynorphin (PDYN), transcript variant 2
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
PDYN (Myc-DDK tagged) - Homo sapiens prodynorphin (PDYN), transcript variant 4
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
PDYN (Myc-DDK tagged) - Homo sapiens prodynorphin (PDYN), transcript variant 5
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti ORF clone of Human prodynorphin (PDYN), transcript variant 1, Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
USD 820.00
6 Weeks
Lenti ORF particles, PDYN (Myc-DDK tagged) - Human prodynorphin (PDYN), transcript variant 1, 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human prodynorphin (PDYN), transcript variant 1, mGFP tagged
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
USD 820.00
6 Weeks
Lenti ORF particles, PDYN (mGFP-tagged) - Human prodynorphin (PDYN), transcript variant 1, 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
PDYN (GFP-tagged) - Human prodynorphin (PDYN), transcript variant 1
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
PDYN (GFP-tagged) - Homo sapiens prodynorphin (PDYN), transcript variant 3
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
PDYN (GFP-tagged) - Homo sapiens prodynorphin (PDYN), transcript variant 2
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
PDYN (GFP-tagged) - Homo sapiens prodynorphin (PDYN), transcript variant 4
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
PDYN (GFP-tagged) - Homo sapiens prodynorphin (PDYN), transcript variant 5
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Rabbit Polyclonal Anti-PDYN Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Pdyn antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: TLTVSGLRGKDDLEDEVALEEGYSALAKLLEPVLKELEKSRLLTSVPEEK |
PDYN (untagged)-Human prodynorphin (PDYN), transcript variant 1
| Vector | pCMV6-XL5 |
| Tag | Tag Free |
| Mammalian Cell Selection | None |
Rabbit Polyclonal Anti-PDYN Antibody - middle region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PDYN antibody: synthetic peptide directed towards the middle region of human PDYN. Synthetic peptide located within the following region: SELMRDAQLNDGAMETGTLYLAEEDPKEQVKRYGGFLRKYPKRSSEVAGE |
Lenti ORF clone of Human prodynorphin (PDYN), transcript variant 1, Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
| Mammalian Cell Selection | None |
- LentiORF®
Lenti ORF clone of Human prodynorphin (PDYN), transcript variant 1, mGFP tagged
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
| Mammalian Cell Selection | None |
- LentiORF®
PDYN HEK293T cell transient overexpression lysate (as WB positive control)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
ProDynorphin (PDYN) (1-13) rabbit polyclonal antibody, Serum
| Applications | IHC, R |
| Reactivities | Guinea Pig, Hamster, Human, Monkey, Porcine, Rat |
| Immunogen | Synthetic peptide, YGGFLRRQFKVVT, corresponding to full-length porcine dynorphin B (1-13), conjugated to thyroglobulin. |
Transient overexpression lysate of prodynorphin (PDYN)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
PDYN (untagged) - Homo sapiens prodynorphin (PDYN), transcript variant 3
| Vector | pCMV6 series |
| Tag | Tag Free |
PDYN (untagged) - Homo sapiens prodynorphin (PDYN), transcript variant 2
| Vector | pCMV6 series |
| Tag | Tag Free |
PDYN (untagged) - Homo sapiens prodynorphin (PDYN), transcript variant 4
| Vector | pCMV6 series |
| Tag | Tag Free |
PDYN (untagged) - Homo sapiens prodynorphin (PDYN), transcript variant 5
| Vector | pCMV6 series |
| Tag | Tag Free |
Transient overexpression of PDYN (NM_024411) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of PDYN (NM_001190892) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of PDYN (NM_001190898) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of PDYN (NM_001190899) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of PDYN (NM_001190900) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of PDYN (NM_024411) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of PDYN (NM_024411) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Transient overexpression of PDYN (NM_001190892) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of PDYN (NM_001190892) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Transient overexpression of PDYN (NM_001190898) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of PDYN (NM_001190898) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Transient overexpression of PDYN (NM_001190899) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of PDYN (NM_001190899) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Transient overexpression of PDYN (NM_001190900) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of PDYN (NM_001190900) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Active filters
Target Symbol
- PDYN
Families
- Secreted Protein