Products

Antibodies (30)

cDNA Clones (22)

Proteins (15)

Jump to Filters

View as table

Loading...

Download Close

Download

1 - 50 of 67 results

Page 1 of 2

(reset)

SIL1 (NM_001037633) Human Tagged ORF Clone

RC204204

USD 420.00

In Stock

SIL1 (Myc-DDK-tagged)-Human SIL1 homolog, endoplasmic reticulum chaperone (S. cerevisiae) (SIL1), transcript variant 1

Vector	pCMV6-Entry
Tag	Myc-DDK
Mammalian Cell Selection	Neomycin

• 

1 / 2

2 / 2

Previous Next

SIL1 (NM_022464) Human Tagged ORF Clone

RC211850

USD 420.00

In Stock

SIL1 (Myc-DDK-tagged)-Human SIL1 homolog, endoplasmic reticulum chaperone (S. cerevisiae) (SIL1), transcript variant 2

Vector	pCMV6-Entry
Tag	Myc-DDK
Mammalian Cell Selection	Neomycin

• 

1 / 2

2 / 2

Previous Next

SIL1 (NM_001037633) Human Tagged ORF Clone Lentiviral Particle

RC204204L1V

USD 820.00

3 Weeks

Lenti ORF particles, SIL1 (Myc-DDK tagged) - Human SIL1 homolog, endoplasmic reticulum chaperone (S. cerevisiae) (SIL1), transcript variant 1, 200ul, >10^7 TU/mL

Vector	pLenti-C-Myc-DDK
Tag	Myc-DDK

• LentiORF^®
• 

SIL1 (NM_001037633) Human Tagged ORF Clone Lentiviral Particle

RC204204L2V

USD 820.00

6 Weeks

Lenti ORF particles, SIL1 (mGFP-tagged) - Human SIL1 homolog, endoplasmic reticulum chaperone (S. cerevisiae) (SIL1), transcript variant 1, 200ul, >10^7 TU/mL

Vector	pLenti-C-mGFP
Tag	mGFP

• LentiORF^®
• 

SIL1 (NM_022464) Human Tagged ORF Clone Lentiviral Particle

RC211850L1V

USD 820.00

4 Weeks

Lenti ORF particles, SIL1 (Myc-DDK tagged) - Human SIL1 homolog, endoplasmic reticulum chaperone (S. cerevisiae) (SIL1), transcript variant 2, 200ul, >10^7 TU/mL

Vector	pLenti-C-Myc-DDK
Tag	Myc-DDK

• LentiORF^®
• 

SIL1 (NM_022464) Human Tagged ORF Clone Lentiviral Particle

RC211850L2V

USD 820.00

6 Weeks

Lenti ORF particles, SIL1 (mGFP-tagged) - Human SIL1 homolog, endoplasmic reticulum chaperone (S. cerevisiae) (SIL1), transcript variant 2, 200ul, >10^7 TU/mL

Vector	pLenti-C-mGFP
Tag	mGFP

• LentiORF^®
• 

SIL1 (NM_001037633) Human Recombinant Protein

TP304204

USD 823.00

In Stock

Recombinant protein of human SIL1 homolog, endoplasmic reticulum chaperone (S. cerevisiae) (SIL1), transcript variant 1

Tag	C-Myc/DDK
Expression Host	HEK293T

• 

SIL1 (NM_001037633) Human Tagged ORF Clone

RG204204

USD 460.00

In Stock

SIL1 (GFP-tagged) - Human SIL1 homolog, endoplasmic reticulum chaperone (S. cerevisiae) (SIL1), transcript variant 1

Vector	pCMV6-AC-GFP
Tag	TurboGFP
Mammalian Cell Selection	Neomycin

• TrueORF^®

SIL1 (NM_022464) Human Tagged ORF Clone

RG211850

USD 460.00

In Stock

SIL1 (GFP-tagged) - Human SIL1 homolog, endoplasmic reticulum chaperone (S. cerevisiae) (SIL1), transcript variant 2

Vector	pCMV6-AC-GFP
Tag	TurboGFP
Mammalian Cell Selection	Neomycin

• TrueORF^®

SIL1 (NM_001037633) Human Tagged ORF Clone

RC204204L3

USD 620.00

3 Weeks

Lenti ORF clone of Human SIL1 homolog, endoplasmic reticulum chaperone (S. cerevisiae) (SIL1), transcript variant 1, Myc-DDK-tagged

Vector	pLenti-C-Myc-DDK-P2A-Puro
Tag	Myc-DDK
Mammalian Cell Selection	Puromycin

• LentiORF^®

SIL1 (NM_001037633) Human Tagged ORF Clone Lentiviral Particle

RC204204L3V

USD 820.00

5 Weeks

Lenti ORF particles, SIL1 (Myc-DDK tagged) - Human SIL1 homolog, endoplasmic reticulum chaperone (S. cerevisiae) (SIL1), transcript variant 1, 200ul, >10^7 TU/mL

Vector	pLenti-C-Myc-DDK-P2A-Puro
Tag	Myc-DDK
Mammalian Cell Selection	Puromycin

• LentiORF^®
• 

SIL1 (NM_001037633) Human Tagged ORF Clone

RC204204L4

USD 620.00

3 Weeks

Lenti ORF clone of Human SIL1 homolog, endoplasmic reticulum chaperone (S. cerevisiae) (SIL1), transcript variant 1, mGFP tagged

Vector	pLenti-C-mGFP-P2A-Puro
Tag	mGFP
Mammalian Cell Selection	Puromycin

• LentiORF^®

SIL1 (NM_001037633) Human Tagged ORF Clone Lentiviral Particle

RC204204L4V

USD 820.00

7 Weeks

Lenti ORF particles, SIL1 (mGFP-tagged) - Human SIL1 homolog, endoplasmic reticulum chaperone (S. cerevisiae) (SIL1), transcript variant 1, 200ul, >10^7 TU/mL

Vector	pLenti-C-mGFP-P2A-Puro
Tag	mGFP
Mammalian Cell Selection	Puromycin

• LentiORF^®
• 

SIL1 (NM_022464) Human Tagged ORF Clone

RC211850L3

USD 620.00

3 Weeks

Lenti ORF clone of Human SIL1 homolog, endoplasmic reticulum chaperone (S. cerevisiae) (SIL1), transcript variant 2, Myc-DDK-tagged

Vector	pLenti-C-Myc-DDK-P2A-Puro
Tag	Myc-DDK
Mammalian Cell Selection	Puromycin

• LentiORF^®

SIL1 (NM_022464) Human Tagged ORF Clone Lentiviral Particle

RC211850L3V

USD 820.00

6 Weeks

Lenti ORF particles, SIL1 (Myc-DDK tagged) - Human SIL1 homolog, endoplasmic reticulum chaperone (S. cerevisiae) (SIL1), transcript variant 2, 200ul, >10^7 TU/mL

Vector	pLenti-C-Myc-DDK-P2A-Puro
Tag	Myc-DDK
Mammalian Cell Selection	Puromycin

• LentiORF^®
• 

SIL1 (NM_022464) Human Tagged ORF Clone

RC211850L4

USD 620.00

3 Weeks

Lenti ORF clone of Human SIL1 homolog, endoplasmic reticulum chaperone (S. cerevisiae) (SIL1), transcript variant 2, mGFP tagged

Vector	pLenti-C-mGFP-P2A-Puro
Tag	mGFP
Mammalian Cell Selection	Puromycin

• LentiORF^®

SIL1 (NM_022464) Human Tagged ORF Clone Lentiviral Particle

RC211850L4V

USD 820.00

6 Weeks

Lenti ORF particles, SIL1 (mGFP-tagged) - Human SIL1 homolog, endoplasmic reticulum chaperone (S. cerevisiae) (SIL1), transcript variant 2, 200ul, >10^7 TU/mL

Vector	pLenti-C-mGFP-P2A-Puro
Tag	mGFP
Mammalian Cell Selection	Puromycin

• LentiORF^®
• 

SIL1 (NM_001037633) Human Tagged ORF Clone

RC204204L1

USD 768.00

In Stock

Lenti ORF clone of Human SIL1 homolog, endoplasmic reticulum chaperone (S. cerevisiae) (SIL1), transcript variant 1, Myc-DDK-tagged

Vector	pLenti-C-Myc-DDK
Tag	Myc-DDK
Mammalian Cell Selection	None

• LentiORF^®

1 / 2

2 / 2

Previous Next

SIL1 (NM_022464) Human Tagged ORF Clone

RC211850L1

USD 768.00

In Stock

Lenti ORF clone of Human SIL1 homolog, endoplasmic reticulum chaperone (S. cerevisiae) (SIL1), transcript variant 2, Myc-DDK-tagged

Vector	pLenti-C-Myc-DDK
Tag	Myc-DDK
Mammalian Cell Selection	None

• LentiORF^®

1 / 2

2 / 2

Previous Next

SIL1 (NM_022464) Human Untagged Clone

SC112483

USD 310.00

In Stock

SIL1 (untagged)-Human SIL1 homolog, endoplasmic reticulum chaperone (S. cerevisiae) (SIL1), transcript variant 2

Vector	pCMV6-XL5
Tag	Tag Free
Mammalian Cell Selection	None

SIL1 (448-461) Goat Polyclonal Antibody

AP22556PU-N

USD 440.00

2 Weeks

SIL1 (448-461) goat polyclonal antibody, Aff - Purified

Applications	ELISA, IHC, WB
Reactivities	Human
Immunogen	Synthetic peptide from C-term of human SIL1

1 / 3

2 / 3

3 / 3

Previous Next

SIL1 (NM_001037633) Human Tagged ORF Clone

RC204204L2

USD 620.00

3 Weeks

Lenti ORF clone of Human SIL1 homolog, endoplasmic reticulum chaperone (S. cerevisiae) (SIL1), transcript variant 1, mGFP tagged

Vector	pLenti-C-mGFP
Tag	mGFP
Mammalian Cell Selection	None

• LentiORF^®

SIL1 (NM_022464) Human Tagged ORF Clone

RC211850L2

USD 620.00

3 Weeks

Lenti ORF clone of Human SIL1 homolog, endoplasmic reticulum chaperone (S. cerevisiae) (SIL1), transcript variant 2, mGFP tagged

Vector	pLenti-C-mGFP
Tag	mGFP
Mammalian Cell Selection	None

• LentiORF^®

SIL1 (NM_022464) Human Over-expression Lysate

LC402924

USD 121.00

In Stock

SIL1 HEK293T cell transient overexpression lysate (as WB positive control)

Tag	C-Myc/DDK
Expression Host	HEK293T
Applications	WB

SIL1 Rabbit Polyclonal Antibody

TA335482

USD 375.00

5 Days

Rabbit Polyclonal Anti-SIL1 Antibody

Applications	IHC, WB
Reactivities	Human
Conjugation	Unconjugated
Immunogen	The immunogen for Anti-SIL1 Antibody: synthetic peptide directed towards the N terminal of human SIL1. Synthetic peptide located within the following region: KETKAEEELDAEVLEVFHPTHEWQALQPGQAVPAGSHVRLNLQTGEREAK

1 / 2

2 / 2

Previous Next

SIL1 (Center) Rabbit Polyclonal Antibody

AP17745PU-N

USD 450.00

2 Weeks

SIL1 (Center) rabbit polyclonal antibody

Applications	WB
Reactivities	Human, Mouse
Immunogen	KLH conjugated synthetic peptide selected from the Center region of human SIL1

SIL1 Goat Polyclonal Antibody

TA302430

USD 375.00

5 Days

Goat Polyclonal Antibody against BAP / SIL1

Applications	WB
Reactivities	Human
Conjugation	Unconjugated
Immunogen	Peptide with sequence C-ELLGSVNSLLKELR, from the C Terminus of the protein sequence according to NP_071909.1.

SIL1 Rabbit Polyclonal Antibody

TA336007

USD 375.00

5 Days

Rabbit Polyclonal Anti-SIL1 Antibody

Applications	WB
Reactivities	Human
Conjugation	Unconjugated
Immunogen	The immunogen for Anti-SIL1 Antibody: synthetic peptide directed towards the C terminal of human SIL1. Synthetic peptide located within the following region: KLQQYRQVHLLPGLWEQGWCEITAHLLALPEHDAREKVLQTLGVLLTTCR

1 / 3

2 / 3

3 / 3

Previous Next

SIL1 / BAP (32-461, His-tag) Human Protein

AR50404PU-N

USD 845.00

2 Weeks

SIL1 / BAP (32-461, His-tag) human recombinant protein, 0.1 mg

Tag	His-tag
Expression Host	E. coli

SIL1 / BAP (32-461, His-tag) Human Protein

AR50404PU-S

USD 330.00

2 Weeks

SIL1 / BAP (32-461, His-tag) human recombinant protein, 20 µg

Tag	His-tag
Expression Host	E. coli

SIL1 Mouse Monoclonal Antibody [Clone ID: OTI1G7]

CF500996

USD 465.00

4 Weeks

Carrier-free (BSA/glycerol-free) SIL1 mouse monoclonal antibody, clone OTI1G7 (formerly 1G7)

Applications	FC, IF, IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated

• 

1 / 6

2 / 6

3 / 6

4 / 6

5 / 6

6 / 6

Previous Next

SIL1 Mouse Monoclonal Antibody [Clone ID: OTI3E3]

CF500997

USD 465.00

4 Weeks

Carrier-free (BSA/glycerol-free) SIL1 mouse monoclonal antibody, clone OTI3E3 (formerly 3E3)

Applications	FC, IF, IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated

• 

1 / 9

2 / 9

3 / 9

4 / 9

5 / 9

6 / 9

7 / 9

8 / 9

9 / 9

Previous Next

SIL1 Mouse Monoclonal Antibody [Clone ID: OTI3B11]

CF501010

USD 465.00

4 Weeks

Carrier-free (BSA/glycerol-free) SIL1 mouse monoclonal antibody, clone OTI3B11 (formerly 3B11)

Applications	FC, IF, IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated

• 

1 / 9

2 / 9

3 / 9

4 / 9

5 / 9

6 / 9

7 / 9

8 / 9

9 / 9

Previous Next

SIL1 Mouse Monoclonal Antibody [Clone ID: OTI1F9]

CF501011

USD 465.00

4 Weeks

Carrier-free (BSA/glycerol-free) SIL1 mouse monoclonal antibody, clone OTI1F9 (formerly 1F9)

Applications	IF, IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated

• 

1 / 15

2 / 15

3 / 15

4 / 15

5 / 15

6 / 15

7 / 15

8 / 15

9 / 15

10 / 15

11 / 15

12 / 15

13 / 15

14 / 15

15 / 15

Previous Next

SIL1 Mouse Monoclonal Antibody [Clone ID: OTI1C4]

CF501043

USD 465.00

4 Weeks

Carrier-free (BSA/glycerol-free) SIL1 mouse monoclonal antibody, clone OTI1C4 (formerly 1C4)

Applications	IF, IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated

• 

1 / 8

2 / 8

3 / 8

4 / 8

5 / 8

6 / 8

7 / 8

8 / 8

Previous Next

SIL1 (NM_001037633) Human Over-expression Lysate

LC421971

USD 121.00

2 Weeks

SIL1 HEK293T cell transient overexpression lysate (as WB positive control)

Tag	C-Myc/DDK
Expression Host	HEK293T
Applications	WB

SIL1 (NM_022464) Human Over-expression Lysate

LY402924

USD 396.00

5 Days

Transient overexpression lysate of SIL1 homolog, endoplasmic reticulum chaperone (S. cerevisiae) (SIL1), transcript variant 2

Tag	C-Myc/DDK
Expression Host	HEK293T
Applications	WB

Special Offer: Get a 20% discount on this product. Use code: "OEL20".

SIL1 (NM_001037633) Human Over-expression Lysate

LY421971

USD 396.00

5 Days

Transient overexpression lysate of SIL1 homolog, endoplasmic reticulum chaperone (S. cerevisiae) (SIL1), transcript variant 1

Tag	C-Myc/DDK
Expression Host	HEK293T
Applications	WB

Special Offer: Get a 20% discount on this product. Use code: "OEL20".

SIL1 (NM_001037633) Human Mass Spec Standard

PH304204

USD 2,055.00

3 Weeks

SIL1 MS Standard C13 and N15-labeled recombinant protein (NP_001032722)

Tag	C-Myc/DDK
Expression Host	HEK293

SIL1 (NM_022464) Human Mass Spec Standard

PH311850

USD 2,055.00

3 Weeks

SIL1 MS Standard C13 and N15-labeled recombinant protein (NP_071909)

Tag	C-Myc/DDK
Expression Host	HEK293

SIL1 (NM_001037633) Human Untagged Clone

SC302917

USD 760.00

3 Weeks

SIL1 (untagged)-Human SIL1 homolog, endoplasmic reticulum chaperone (S. cerevisiae) (SIL1), transcript variant 1

Vector	pCMV6-Entry
Tag	Tag Free
Mammalian Cell Selection	Neomycin

SIL1 Mouse Monoclonal Antibody [Clone ID: OTI1G7]

TA500996

USD 379.00

In Stock

Anti-SIL1 mouse monoclonal antibody, clone OTI1G7 (formerly 1G7)

Applications	FC, IF, IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated

• 

1 / 6

2 / 6

3 / 6

4 / 6

5 / 6

6 / 6

Previous Next

SIL1 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI1G7]

TA500996AM

USD 420.00

4 Weeks

Anti-SIL1 mouse monoclonal antibody, clone OTI1G7 (formerly 1G7), Biotinylated

Applications	FC, IF, IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Biotin

• 

1 / 6

2 / 6

3 / 6

4 / 6

5 / 6

6 / 6

Previous Next

SIL1 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI1G7]

TA500996BM

USD 420.00

4 Weeks

Anti-SIL1 mouse monoclonal antibody, clone OTI1G7 (formerly 1G7), HRP conjugated

Applications	FC, IF, IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	HRP

• 

1 / 6

2 / 6

3 / 6

4 / 6

5 / 6

6 / 6

Previous Next

SIL1 Mouse Monoclonal Antibody [Clone ID: OTI1G7]

TA500996S

USD 159.00

2 Days

Anti-SIL1 mouse monoclonal antibody, clone OTI1G7 (formerly 1G7)

Applications	FC, IF, IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated

• 

1 / 6

2 / 6

3 / 6

4 / 6

5 / 6

6 / 6

Previous Next

SIL1 Mouse Monoclonal Antibody [Clone ID: OTI3E3]

TA500997

USD 379.00

In Stock

Anti-SIL1 mouse monoclonal antibody, clone OTI3E3 (formerly 3E3)

Applications	FC, IF, IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated

• 

1 / 9

2 / 9

3 / 9

4 / 9

5 / 9

6 / 9

7 / 9

8 / 9

9 / 9

Previous Next

SIL1 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI3E3]

TA500997AM

USD 420.00

4 Weeks

Anti-SIL1 mouse monoclonal antibody, clone OTI3E3 (formerly 3E3), Biotinylated

Applications	FC, IF, IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Biotin

• 

1 / 9

2 / 9

3 / 9

4 / 9

5 / 9

6 / 9

7 / 9

8 / 9

9 / 9

Previous Next

SIL1 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI3E3]

TA500997BM

USD 420.00

4 Weeks

Anti-SIL1 mouse monoclonal antibody, clone OTI3E3 (formerly 3E3), HRP conjugated

Applications	FC, IF, IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	HRP

• 

1 / 9

2 / 9

3 / 9

4 / 9

5 / 9

6 / 9

7 / 9

8 / 9

9 / 9

Previous Next

SIL1 Mouse Monoclonal Antibody [Clone ID: OTI3E3]

TA500997S

USD 159.00

2 Days

Anti-SIL1 mouse monoclonal antibody, clone OTI3E3 (formerly 3E3)

Applications	FC, IF, IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated

• 

1 / 9

2 / 9

3 / 9

4 / 9

5 / 9

6 / 9

7 / 9

8 / 9

9 / 9

Previous Next

SIL1 Mouse Monoclonal Antibody [Clone ID: OTI3B11]

TA501010

USD 379.00

In Stock

Anti-SIL1 mouse monoclonal antibody, clone OTI3B11 (formerly 3B11)

Applications	FC, IF, IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated

• 

1 / 9

2 / 9

3 / 9

4 / 9

5 / 9

6 / 9

7 / 9

8 / 9

9 / 9

Previous Next

1 - 50 of 67 results

Page 1 of 2