Products

Antibodies (14)
cDNA Clones (10)
Proteins (7)
Jump to Filters
View as table Download
Stanniocalcin 1 (STC1) (NM_003155) Human Tagged ORF Clone
RC206573

USD 98.00

USD 390.00

In Stock

STC1 (Myc-DDK-tagged)-Human stanniocalcin 1 (STC1)

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
Stanniocalcin 1 (STC1) (NM_003155) Human Tagged ORF Clone
RG206573

USD 460.00

In Stock

STC1 (GFP-tagged) - Human stanniocalcin 1 (STC1)

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
Stanniocalcin 1 (STC1) (NM_003155) Human Untagged Clone
SC111027

USD 310.00

In Stock

STC1 (untagged)-Human stanniocalcin 1 (STC1)

Vector pCMV6-XL5
Tag Tag Free
Mammalian Cell Selection None
Stanniocalcin 1 (STC1) (NM_003155) Human Recombinant Protein
TP760132

USD 215.00

In Stock

Recombinant protein of human stanniocalcin 1 (STC1), full length, with N-terminal HIS tag, expressed in E.Coli, 50ug

Tag N-His
Expression Host E. coli
Stanniocalcin 1 (STC1) (NM_003155) Human Over-expression Lysate
LY401098

USD 396.00

In Stock

Transient overexpression lysate of stanniocalcin 1 (STC1)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
Stanniocalcin 1 (STC1) Rabbit Polyclonal Antibody
TA346344

USD 475.00

5 Days

Rabbit Polyclonal Anti-STC1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-STC1 antibody: synthetic peptide directed towards the N terminal of human STC1. Synthetic peptide located within the following region: MLQNSAVLLVLVISASATHEAEQNDSVSPRKSRVAAQNSAEVVRCLNSAL
Stanniocalcin 1 (STC1) (NM_003155) Human Tagged ORF Clone
RC206573L2

USD 620.00

3 Weeks

Lenti ORF clone of Human stanniocalcin 1 (STC1), mGFP tagged

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®
Stanniocalcin 1 (STC1) (NM_003155) Human Untagged Clone
SC324585

USD 310.00

In Stock

STC1 (untagged)-Human stanniocalcin 1 (STC1)

Vector pCMV6-AC
Tag Tag Free
Mammalian Cell Selection Neomycin
Stanniocalcin 1 (STC1) (NM_003155) Human Recombinant Protein
TP700021

USD 748.00

In Stock

Recombinant protein of mature form of human stanniocalcin 1 (STC1) with C-terminal DDK/His tag, expressed in human cells

Tag C-DDK/His
Expression Host HEK293
Stanniocalcin 1 (STC1) (NM_003155) Human Over-expression Lysate
LC401098

USD 121.00

In Stock

STC1 HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Stanniocalcin 1 (STC1) (C-term) Rabbit Polyclonal Antibody
AP54070PU-N

USD 450.00

2 Weeks

Stanniocalcin 1 (STC1) (C-term) rabbit polyclonal antibody, Aff - Purified

Applications WB
Reactivities Human
Immunogen Synthetic peptide - KLH conjugated - corresponding to the C-terminal region (between 192-221aa) of human Stanniocalcin-1.
Stanniocalcin 1 (STC1) Mouse Monoclonal Antibody [Clone ID: OTI1E9]
CF809955

USD 465.00

In Stock

Carrier-free (BSA/glycerol-free) STC1 mouse monoclonal antibody,clone OTI1E9

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Stanniocalcin 1 (STC1) Rabbit Polyclonal Antibody
TA350454

USD 345.00

In Stock

Rabbit Polyclonal Anti-STC1 Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human STC1
Stanniocalcin 1 (STC1) Mouse Monoclonal Antibody [Clone ID: OTI1E9]
TA809955

USD 379.00

In Stock

STC1 mouse monoclonal antibody,clone OTI1E9

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Stanniocalcin 1 (STC1) Mouse Monoclonal Antibody [Clone ID: OTI1E9]
TA809955S

USD 159.00

2 Days

STC1 mouse monoclonal antibody,clone OTI1E9

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Stanniocalcin 1 (STC1) ICC Control Block
TB406573

USD 1,040.00

4 Weeks

Transient overexpression of STC1 (NM_003155) in HEK293T cells paraffin embedded controls for ICC/IHC staining

Stanniocalcin 1 (STC1) Cytosection
TS406573

USD 225.00

4 Weeks

Transient overexpression of STC1 (NM_003155) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

Stanniocalcin 1 (STC1) Cytosection
TS406573P5

USD 889.00

4 Weeks

Transient overexpression of STC1 (NM_003155) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack