Germany
Japan
United Kingdom
China
CCNA2 (Myc-DDK-tagged)-Human cyclin A2 (CCNA2)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
Products
View as table Download
Recombinant protein of human cyclin A2 (CCNA2)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
Special Offer: Get a 20% discount on this product. Use code: "MVPro20".
USD 820.00
3 Weeks
Lenti ORF particles, CCNA2 (Myc-DDK tagged) - Human cyclin A2 (CCNA2), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
- LentiORF®
-
USD 820.00
6 Weeks
Lenti ORF particles, CCNA2 (mGFP-tagged) - Human cyclin A2 (CCNA2), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
- LentiORF®
-
CCNA2 (GFP-tagged) - Human cyclin A2 (CCNA2)
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti ORF clone of Human cyclin A2 (CCNA2), Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
USD 820.00
5 Weeks
Lenti ORF particles, CCNA2 (Myc-DDK tagged) - Human cyclin A2 (CCNA2), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
USD 820.00
3 Weeks
Lenti ORF particles, CCNA2 (mGFP-tagged) - Human cyclin A2 (CCNA2), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
CCNA2 (untagged)-Human cyclin A2 (CCNA2)
| Vector | pCMV6-XL4 |
| Tag | Tag Free |
| Mammalian Cell Selection | None |
Lenti ORF clone of Human cyclin A2 (CCNA2), Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
| Mammalian Cell Selection | None |
- LentiORF®
Transient overexpression lysate of cyclin A2 (CCNA2)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
CCNA2 HEK293T cell transient overexpression lysate (as WB positive control)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
Lenti ORF clone of Human cyclin A2 (CCNA2), mGFP tagged
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
| Mammalian Cell Selection | None |
- LentiORF®
Cyclin A2 (CCNA2) mouse monoclonal antibody, clone CY-28, Purified
| Applications | IF, WB |
| Reactivities | Human, Mouse |
Rabbit Polyclonal Anti-CCNA2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CCNA2 antibody: synthetic peptide directed towards the C terminal of human CCNA2. Synthetic peptide located within the following region: YTLESLKPCLMDLHQTYLKAPQHAQQSIREKYKNSKYHGVSLLNPPETLNL |
Mouse monoclonal Anti-CyclinA Clone AT10.2
| Reactivities | Human |
| Conjugation | Unconjugated |
Rabbit anti Cyclin A Polyclonal Antibody
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Cyclin A2 (1-432, His-tag) human recombinant protein, 0.5 mg
| Tag | His-tag |
| Expression Host | E. coli |
Cyclin A2 (1-432, His-tag) human recombinant protein, 0.1 mg
| Tag | His-tag |
| Expression Host | E. coli |
CCNA2 MS Standard C13 and N15-labeled recombinant protein (NP_001228)
| Tag | C-Myc/DDK |
| Expression Host | HEK293 |
Transient overexpression of CCNA2 (NM_001237) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of CCNA2 (NM_001237) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of CCNA2 (NM_001237) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Active filters
Target Symbol
- CCNA2
Families
- Stem cell - Pluripotency