FEN1 (Myc-DDK-tagged)-Human flap structure-specific endonuclease 1 (FEN1)
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
FEN1 (Myc-DDK-tagged)-Human flap structure-specific endonuclease 1 (FEN1)
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
Lenti ORF particles, FEN1 (mGFP-tagged) - Human flap structure-specific endonuclease 1 (FEN1), 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Recombinant protein of human flap structure-specific endonuclease 1 (FEN1)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Special Offer: Get a 20% discount on this product. Use code: "MVPro20".
FEN1 (GFP-tagged) - Human flap structure-specific endonuclease 1 (FEN1)
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
Lenti ORF particles, FEN1 (Myc-DDK tagged) - Human flap structure-specific endonuclease 1 (FEN1), 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK |
Tag | Myc-DDK |
Lenti ORF particles, FEN1 (mGFP-tagged) - Human flap structure-specific endonuclease 1 (FEN1), 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP |
Tag | mGFP |
Lenti ORF clone of Human flap structure-specific endonuclease 1 (FEN1), Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, FEN1 (Myc-DDK tagged) - Human flap structure-specific endonuclease 1 (FEN1), 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF clone of Human flap structure-specific endonuclease 1 (FEN1), Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK |
Tag | Myc-DDK |
Mammalian Cell Selection | None |
Lenti ORF clone of Human flap structure-specific endonuclease 1 (FEN1), mGFP tagged
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
FEN1 (untagged)-Human flap structure-specific endonuclease 1 (FEN1)
Vector | pCMV6-XL5 |
Tag | Tag Free |
Mammalian Cell Selection | None |
Rabbit polyclonal anti-FEN1 antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human FEN1. |
Transient overexpression lysate of flap structure-specific endonuclease 1 (FEN1)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
Lenti ORF clone of Human flap structure-specific endonuclease 1 (FEN1), mGFP tagged
Vector | pLenti-C-mGFP |
Tag | mGFP |
Mammalian Cell Selection | None |
Rabbit anti-FEN1 Polyclonal Antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human FEN1 |
FEN1 HEK293T cell transient overexpression lysate (as WB positive control)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Rabbit polyclonal FEN1 Antibody (Center)
Applications | IF, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | This FEN1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 243-272 amino acids from the Central region of human FEN1. |
Mouse Monoclonal FEN-1 Antibody
Applications | IF, WB |
Reactivities | Hamster, Human, Monkey, Mouse, Rat |
Conjugation | Unconjugated |
Mouse Monoclonal FEN-1 Antibody
Applications | IP, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Rabbit Polyclonal Anti-FEN1 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-FEN1 antibody: synthetic peptide directed towards the C terminal of human FEN1. Synthetic peptide located within the following region: PNEEELIKFMCGEKQFSEERIRSGVKRLSKSRQGSTQGRLDDFFKVTGSL |
FEN1 / RAD2 (1-380) human recombinant protein, 0.5 mg
Expression Host | E. coli |
FEN1 / RAD2 (1-380) human recombinant protein, 0.1 mg
Expression Host | E. coli |
Carrier-free (BSA/glycerol-free) FEN1 mouse monoclonal antibody, clone OTI1F3 (formerly 1F3)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) FEN1 mouse monoclonal antibody, clone OTI1E1 (formerly 1E1)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) FEN1 mouse monoclonal antibody, clone OTI3A8 (formerly 3A8)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) FEN1 mouse monoclonal antibody, clone OTI2B2 (formerly 2B2)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
FEN1 MS Standard C13 and N15-labeled recombinant protein (NP_004102)
Tag | C-Myc/DDK |
Expression Host | HEK293 |
FEN1 mouse monoclonal antibody, clone OTI1F3 (formerly 1F3)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
FEN1 mouse monoclonal antibody,clone 1F3, Biotinylated
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Biotin |
FEN1 mouse monoclonal antibody,clone 1F3, HRP conjugated
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | HRP |
FEN1 mouse monoclonal antibody, clone OTI1F3 (formerly 1F3)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
FEN1 mouse monoclonal antibody, clone OTI1E1 (formerly 1E1)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
FEN1 mouse monoclonal antibody,clone 1E1, Biotinylated
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Biotin |
FEN1 mouse monoclonal antibody,clone 1E1, HRP conjugated
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | HRP |
FEN1 mouse monoclonal antibody, clone OTI1E1 (formerly 1E1)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
FEN1 mouse monoclonal antibody, clone OTI3A8 (formerly 3A8)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
FEN1 mouse monoclonal antibody,clone 3A8, Biotinylated
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Biotin |
FEN1 mouse monoclonal antibody,clone 3A8, HRP conjugated
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | HRP |
FEN1 mouse monoclonal antibody, clone OTI3A8 (formerly 3A8)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
FEN1 mouse monoclonal antibody, clone OTI2B2 (formerly 2B2)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
FEN1 mouse monoclonal antibody,clone 2B2, Biotinylated
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Biotin |
FEN1 mouse monoclonal antibody,clone 2B2, HRP conjugated
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | HRP |
FEN1 mouse monoclonal antibody, clone OTI2B2 (formerly 2B2)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Transient overexpression of FEN1 (NM_004111) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Recombinant protein of human flap structure-specific endonuclease 1 (FEN1)
Tag | tag free |
Expression Host | E. coli |
Recombinant protein of human flap structure-specific endonuclease 1 (FEN1)
Tag | tag free |
Expression Host | E. coli |
Recombinant protein of human flap structure-specific endonuclease 1 (FEN1)
Tag | tag free |
Expression Host | E. coli |
Recombinant protein of human flap structure-specific endonuclease 1 (FEN1)
Tag | tag free |
Expression Host | E. coli |
Transient overexpression of FEN1 (NM_004111) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of FEN1 (NM_004111) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack