Products

cDNA Clones (30)
Proteins (24)
Antibodies (6)
Jump to Filters
View as table Download
LAP2 (TMPO) (NM_003276) Human Tagged ORF Clone
RC215545

USD 770.00

In Stock

TMPO (Myc-DDK-tagged)-Human thymopoietin (TMPO), transcript variant 1

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
LAP2 (TMPO) (NM_001032284) Human Tagged ORF Clone
RC222866

USD 420.00

In Stock

TMPO (Myc-DDK-tagged)-Human thymopoietin (TMPO), transcript variant 3

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
LAP2 (TMPO) Rabbit Polyclonal Antibody
TA332546

USD 374.00

3 Weeks

Rabbit anti-TMPO Polyclonal Antibody

Applications ICC/IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human TMPO
LAP2 (TMPO) (NM_001032283) Human Tagged ORF Clone
RC208781L3

USD 620.00

3 Weeks

Lenti ORF clone of Human thymopoietin (TMPO), transcript variant 2, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
LAP2 (TMPO) (NM_001032283) Human Tagged ORF Clone
RC208781L4

USD 620.00

3 Weeks

Lenti ORF clone of Human thymopoietin (TMPO), transcript variant 2, mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
LAP2 (TMPO) (NM_003276) Human Tagged ORF Clone
RC215545L3

USD 970.00

3 Weeks

Lenti ORF clone of Human thymopoietin (TMPO), transcript variant 1, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
LAP2 (TMPO) (NM_003276) Human Tagged ORF Clone
RC215545L4

USD 970.00

3 Weeks

Lenti ORF clone of Human thymopoietin (TMPO), transcript variant 1, mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
LAP2 (TMPO) (NM_001032284) Human Tagged ORF Clone
RC222866L3

USD 620.00

3 Weeks

Lenti ORF clone of Human thymopoietin (TMPO), transcript variant 3, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
LAP2 (TMPO) (NM_001032284) Human Tagged ORF Clone
RC222866L4

USD 620.00

3 Weeks

Lenti ORF clone of Human thymopoietin (TMPO), transcript variant 3, mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
LAP2 (TMPO) (NM_001032283) Human Tagged ORF Clone
RG208781

USD 460.00

3 Weeks

TMPO (GFP-tagged) - Human thymopoietin (TMPO), transcript variant 2

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
LAP2 (TMPO) (NM_003276) Human Tagged ORF Clone
RG215545

USD 850.00

3 Weeks

TMPO (GFP-tagged) - Human thymopoietin (TMPO), transcript variant 1

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
LAP2 (TMPO) (NM_001032284) Human Tagged ORF Clone
RG222866

USD 460.00

3 Weeks

TMPO (GFP-tagged) - Human thymopoietin (TMPO), transcript variant 3

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
LAP2 (TMPO) (NM_001032283) Human Tagged ORF Clone
RC208781L1

USD 620.00

In Stock

Lenti ORF clone of Human thymopoietin (TMPO), transcript variant 2, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
Mammalian Cell Selection None
  • LentiORF®
LAP2 (TMPO) (NM_001032284) Human Tagged ORF Clone
RC222866L1

USD 620.00

In Stock

Lenti ORF clone of Human thymopoietin (TMPO), transcript variant 3, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
Mammalian Cell Selection None
  • LentiORF®
LAP2 (TMPO) (NM_001032283) Human Tagged ORF Clone
RC208781L2

USD 620.00

3 Weeks

Lenti ORF clone of Human thymopoietin (TMPO), transcript variant 2, mGFP tagged

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®
LAP2 (TMPO) (NM_001032284) Human Tagged ORF Clone
RC222866L2

USD 620.00

3 Weeks

Lenti ORF clone of Human thymopoietin (TMPO), transcript variant 3, mGFP tagged

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®
LAP2 (TMPO) (NM_003276) Human Untagged Clone
SC108508

USD 1,410.00

In Stock

TMPO (untagged)-Human thymopoietin (TMPO), transcript variant 1

Vector pCMV6-XL5
Tag Tag Free
Mammalian Cell Selection None
LAP2 (TMPO) (NM_001032283) Human Over-expression Lysate
LC422295

USD 121.00

In Stock

TMPO HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
LAP2 (TMPO) (NM_001032283) Human Over-expression Lysate
LY422295

USD 396.00

In Stock

Transient overexpression lysate of thymopoietin (TMPO), transcript variant 2

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
LAP2 (TMPO) (AF113682) Human Untagged Clone
SC106200

USD 660.00

In Stock

(untagged)-Human clone FLB3436 PRO0868 mRNA, complete cds

Vector pCMV6-XL6
Tag Tag Free
Mammalian Cell Selection None
LAP2 (TMPO) Rabbit Polyclonal Antibody
TA319722

USD 430.00

5 Days

Rabbit Polyclonal Thymopoietin Antibody

Applications IF, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Thymopoietin antibody was raised against a 19 amino acid synthetic peptide near the amino terminus of human Thymopoietin.
LAP2 (TMPO) (NM_003276) Human Recombinant Protein
TP761176

USD 215.00

In Stock

Purified recombinant protein of Human thymopoietin (TMPO), transcript variant 1, full length, with N-terminal HIS tag, expressed in E. coli, 50ug

Tag N-His
Expression Host E. coli
LAP2 (TMPO) (N-term) Rabbit Polyclonal Antibody
AP54295PU-N

USD 450.00

2 Weeks

LAP2 (TMPO) (N-term) rabbit polyclonal antibody, Aff - Purified

Applications WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide between 165-195 amino acids from the N-terminal region of human TMPO
LAP2 (TMPO) Rabbit Polyclonal Antibody
TA336033

USD 375.00

5 Days

Rabbit Polyclonal Anti-TMPO Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-TMPO Antibody: synthetic peptide directed towards the N terminal of human TMPO. Synthetic peptide located within the following region: MPEFLEDPSVLTKDKLKSELVANNVTLPAGEQRKDVYVQLYLQHLTARNR
LAP2 (TMPO) Rabbit Polyclonal Antibody
TA336034

USD 375.00

5 Days

Rabbit Polyclonal Anti-TMPO Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-TMPO Antibody: synthetic peptide directed towards the N terminal of human TMPO. Synthetic peptide located within the following region: PEFLEDPSVLTKDKLKSELVANNVTLPAGEQRKDVYVQLYLQHLTARNRP
LAP2 (TMPO) Rabbit Polyclonal Antibody
TA336035

USD 375.00

5 Days

Rabbit Polyclonal Anti-TMPO Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-TMPO Antibody: synthetic peptide directed towards the middle region of human TMPO. Synthetic peptide located within the following region: EKKLLKLREQGTESRSSTPLPTISSSAENTRQNGSNDSDRYSDNEEDSKI
LAP2 (TMPO) (NM_003276) Human Over-expression Lysate
LC418798

USD 187.00

2 Weeks

TMPO HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
LAP2 (TMPO) (NM_001032284) Human Over-expression Lysate
LC422296

USD 121.00

2 Weeks

TMPO HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
LAP2 (TMPO) (NM_001032284) Human Over-expression Lysate
LC425526

USD 121.00

2 Weeks

TMPO HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
LAP2 (TMPO) (NM_003276) Human Over-expression Lysate
LY418798

USD 605.00

5 Days

Transient overexpression lysate of thymopoietin (TMPO), transcript variant 1

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
LAP2 (TMPO) (NM_001032284) Human Over-expression Lysate
LY422296

USD 396.00

5 Days

Transient overexpression lysate of thymopoietin (TMPO), transcript variant 3

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
LY422296 is the same product as LY425526.
LAP2 (TMPO) (NM_001032284) Human Over-expression Lysate
LY425526

USD 396.00

5 Days

Transient overexpression lysate of thymopoietin (TMPO), transcript variant 3

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
LAP2 (TMPO) (NM_001032283) Human Mass Spec Standard
PH308781

USD 2,055.00

3 Weeks

TMPO MS Standard C13 and N15-labeled recombinant protein (NP_001027454)

Tag C-Myc/DDK
Expression Host HEK293
LAP2 (TMPO) (NM_001032283) Human Untagged Clone
SC302623

USD 760.00

3 Weeks

TMPO (untagged)-Human thymopoietin (TMPO), transcript variant 2

Vector pCMV6-Entry
Tag Tag Free
Mammalian Cell Selection Neomycin
LAP2 (TMPO) (NM_001032284) Human Untagged Clone
SC302624

USD 590.00

3 Weeks

TMPO (untagged)-Human thymopoietin (TMPO), transcript variant 3

Vector pCMV6-Entry
Tag Tag Free
Mammalian Cell Selection Neomycin
LAP2 (TMPO) ICC Control Block
TB408781

USD 1,070.00

4 Weeks

Transient overexpression of TMPO (NM_001032283) in HEK293T cells paraffin embedded controls for ICC/IHC staining

LAP2 (TMPO) ICC Control Block
TB415545

USD 1,420.00

4 Weeks

Transient overexpression of TMPO (NM_003276) in HEK293T cells paraffin embedded controls for ICC/IHC staining

LAP2 (TMPO) ICC Control Block
TB422866

USD 1,070.00

4 Weeks

Transient overexpression of TMPO (NM_001032284) in HEK293T cells paraffin embedded controls for ICC/IHC staining