Germany
Japan
United Kingdom
China
Lenti ORF clone of Human MYC associated factor X (MAX), transcript variant 2, Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
| Mammalian Cell Selection | None |
- LentiORF®
Products
View as table Download
MAX (untagged)-Human MYC associated factor X (MAX), transcript variant 5
| Vector | pCMV6-XL4 |
| Tag | Tag Free |
| Mammalian Cell Selection | None |
MAX (untagged)-Human MYC associated factor X (MAX), transcript variant 3
| Vector | pCMV6-XL5 |
| Tag | Tag Free |
| Mammalian Cell Selection | None |
Rabbit Polyclonal Anti-MAX Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-MAX antibody: synthetic peptide directed towards the n terminal of human MAX. Synthetic peptide located within the following region: MSDNDDIEVESDADKRAHHNALERKRRDHIKDSFHSLRDSVPSLQGEKAS |
Lenti ORF clone of Human MYC associated factor X (MAX), transcript variant 2, mGFP tagged
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
| Mammalian Cell Selection | None |
- LentiORF®
Lenti-ORF clone of MAX (Myc-DDK-tagged)-Human MYC associated factor X (MAX), transcript variant 1
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
| Mammalian Cell Selection | None |
- LentiORF®
Lenti-ORF clone of MAX (mGFP-tagged)-Human MYC associated factor X (MAX), transcript variant 1
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
| Mammalian Cell Selection | None |
- LentiORF®
MAX (untagged)-Human MYC associated factor X, transcript variant 2, mRNA (cDNA clone MGC:10775 IMAGE:3607261), complete cds
| Vector | pCMV6-XL5 |
| Tag | Tag Free |
| Mammalian Cell Selection | None |
MAX (untagged)-Human MYC associated factor X (MAX), transcript variant 6
| Vector | pCMV6-XL4 |
| Tag | Tag Free |
| Mammalian Cell Selection | None |
MAX (untagged)-Human MYC associated factor X (MAX), transcript variant 4
| Vector | pCMV6-AC |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
MAX (1-160, His-tag) human recombinant protein, 0.1 mg
| Tag | His-tag |
| Expression Host | E. coli |
Transient overexpression lysate of MYC associated factor X (MAX), transcript variant 3
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Goat Polyclonal Antibody against MAX
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-EEPQSRKKLRMEAS, from the C Terminus of the protein sequence according to NP_002373. |
Anti-MAX Rabbit Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Full length fusion protein |
Rabbit Polyclonal Anti-MAX Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-MAX antibody: synthetic peptide directed towards the n terminal of human MAX. Synthetic peptide located within the following region: MSDNDDIEVESDADKRAHHNALERKRRDHIKDSFHSLRDSVPSLQGEKAS |
Rabbit Polyclonal Anti-MAX Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-MAX Antibody: synthetic peptide directed towards the middle region of human MAX. Synthetic peptide located within the following region: LQTNYPSSDNSLYTNAKGSTISAFDGGSDSSSESEPEEPQSRKKLRMEAS |
MAX (1-160, His-tag) human recombinant protein, 0.5 mg
| Tag | His-tag |
| Expression Host | E. coli |
Carrier-free (BSA/glycerol-free) MAX mouse monoclonal antibody,clone OTI1D6
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) MAX mouse monoclonal antibody,clone OTI14G1
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) MAX mouse monoclonal antibody,clone OTI5F5
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) MAX mouse monoclonal antibody,clone OTI6H1
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
MAX HEK293T cell transient overexpression lysate (as WB positive control)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
MAX HEK293T cell transient overexpression lysate (as WB positive control)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
MAX HEK293T cell transient overexpression lysate (as WB positive control)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
MAX HEK293T cell transient overexpression lysate (as WB positive control)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Transient overexpression lysate of MYC associated factor X (MAX), transcript variant 4
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Transient overexpression lysate of MYC associated factor X (MAX), transcript variant 5
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
MAX MS Standard C13 and N15-labeled recombinant protein (NP_660089)
| Tag | C-Myc/DDK |
| Expression Host | HEK293 |
MAX MS Standard C13 and N15-labeled recombinant protein (NP_660092)
| Tag | C-Myc/DDK |
| Expression Host | HEK293 |
MAX MS Standard C13 and N15-labeled recombinant protein (NP_660087)
| Tag | C-Myc/DDK |
| Expression Host | HEK293 |
MAX MS Standard C13 and N15-labeled recombinant protein (NP_660088)
| Tag | C-Myc/DDK |
| Expression Host | HEK293 |
MAX (GFP-tagged) - Human MYC associated factor X (MAX), transcript variant 8
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
MAX (untagged) - Homo sapiens MYC associated factor X (MAX), transcript variant 7
| Vector | pCMV6 series |
| Tag | Tag Free |
MAX (untagged) - Human MYC associated factor X (MAX), transcript variant 8
| Vector | pCMV6-Entry |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
MAX mouse monoclonal antibody,clone OTI1D6
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
MAX mouse monoclonal antibody,clone OTI1D6
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
MAX mouse monoclonal antibody,clone OTI14G1
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
MAX mouse monoclonal antibody,clone OTI14G1
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
MAX mouse monoclonal antibody,clone OTI5F5
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
MAX mouse monoclonal antibody,clone OTI5F5
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
MAX mouse monoclonal antibody,clone OTI6H1
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
MAX mouse monoclonal antibody,clone OTI6H1
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Transient overexpression of MAX (NM_145114) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of MAX (NM_145116) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of MAX (NM_145112) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of MAX (NM_002382) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of MAX (NM_197957) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of MAX (NM_145113) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of MAX (NM_001271068) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Active filters
Target Symbol
- MAX
Families
- Transcription Factors